IFN a 2a Human

IFN a 2a Human

Cytokines

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    IFN a 2a Human

    Description:

    IFN-Alpha 2a Human Recombinant

    Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a.

    Product # :

    CYT-204

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add :

  • description
  • source
  • formulation
  • purity
  • biological activity
  • More Info

Description

IFN Alpha Human 2a Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 19241 Dalton. The difference between IFNA2A and IFNA2B is in the amino acid present at position 23. IFN-alpha 2a has a lysine at that position 23 while IFN-alpha 2b has arginine.The Interferon-alpha-2a gene was obtained from human leukocytes.The IFNA2A is purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Formulation

Lyophilized without additives.

Purity

Greater than 97.0% as determined by both:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Biological Activity

The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg.

More Info

  • Introduction

    IFN-alpha is produced by macrophages and has antiviral activities. IFN stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.

  • Synonyms

    Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a.

  • Physical Appearance

    Sterile Filtered White lyophilized (freeze-dried) powder.

  • Stability

    Lyophilized IFNA-2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN-alpha 2a should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

  • Solubility

    It is recommended to reconstitute the lyophilized Interferon-alpha-2a in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

  • Amino Acid Sequence

    CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE.

    N-terminal methionine has been completely removed enzymatically.

  • Protein content

    Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.924 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IFN-a 2a as a Reference Standard.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Interferon Alpha 2A Human

You may also like

Frequently asked questions

1. Which company offers Recombinant cytokines at competitive prices?

ProSpec offers vast array of cytokines such as Interferon-alpha | Interleukin-2 | TNF-alpha | BMP-2 and much more at affordable descent prices to meet academic budgets.
ProSpec provides High Purity cytokines for 30 years, purity exhibits 95% or more by SDS-PAGE gel.
Cytokines are in stock for immediate delivery via FedEx which enables scientists and researchers to perform immediate experiments.
Cytokines are shipped globally using ProSpec’s custom tailored Styrofoam insulated box and premium ice packs that ensure maximum protein stability during transit to your laboratory.

2. Where can i find biologically active cytokines?

ProSpec offers biologically functional cytokines such as Adiponectin | Cardiotrophin | Beta Defensin which are rigorously tested in-vitro to provide researchers world wide BioActive Cytokines.