HTNV

HTNV

Hantavirus

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    HTNV

    Description:

    Hantavirus Recombinant

    HTNV, Hantaan Virus, Hantanvirus.

    Product # :

    HTV-001

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add :

  • description
  • source
  • formulation
  • purity
  • More Info

Description

The Hantavirus nucleocapsid (N) fusion protein is expressed in E. coli and is fused to 6xHis tag. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.

Source

E.Coli

Formulation

HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.

Purity

HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining).

More Info

  • Synonyms

    HTNV, Hantaan Virus, Hantanvirus.

  • Physical Appearance

    Sterile filtered colorless solution.

  • Stability

    Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles.

  • Amino Acid Sequence

    GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD

  • Background

    What is the source or expression system of Hantavirus- Nucleocapsid Protein?
    Escherichia Coli.

    What is the Purity of Hantavirus- Nucleocapsid Protein?
    Hantavirus- Nucleocapsid Protein is >95% pure as determined by SDS-PAGE.

    Is Hantavirus- Nucleocapsid conjugated to a Tag?
    Hantavirus- Nucleocapsid is fused to 6xHis.

    What is the Biological Activity of Hantavirus- Nucleocapsid Protein?
    The biological functionality of Hantavirus- Nucleocapsid Protein will be determined in the future.

    What is the endotoxin level for Hantavirus- Nucleocapsid Protein?
    The endotoxin level is minimal, Hantavirus- Nucleocapsid Protein was purified using conventional chromatography techniques.

    What applications can Hantavirus- Nucleocapsid Protein be used in?
    Hantavirus-Nucleocapsid Protein can probably be used in Immunoassay.

    What is the function of the hantavirus nucleocapsid (N) protein?
    The hantavirus nucleocapsid (N) protein surrounds the viral RNA binding site and protects it during viral replication and assembly.

    Why is hantavirus nucleocapsid protein commonly used in ELISA assays?
    The hantavirus N protein is highly immunogenic, conserved and widely expressed and induces a strong antibody response in infected individuals.

    Does hantavirus N protein bind RNA?
    Hantavirus N protein contains RNA-binding domains that specifically interact with viral genomic

    Is the hantavirus nucleocapsid protein suitable for antibody production?
    Resulting from high immunogenicity, recombinant hantavirus N protein is highly used as an immunogen for generating both polyclonal and monoclonal antibodies.

  • Purification Method

    Purified by proprietary chromatographic technique.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Hantavirus Protein

You may also like