Hantavirus

Hantavirus

Hantavirus

Name

Description

Product #

Price

Quantity

Shipping Method

  • View Data Sheet

    Description:

    Hantavirus Recombinant (1-200 a.a.)

    HTNV, Hantaan Virus, Hantanvirus.

    Product # :

    HTV-002

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The Hantavirus Recombinant (1-200 a.a.) protein is expressed in E. coli and is fused to a Six histidine tag at C-terminus and has a MW of 23.8kDa (pI 7.96).

    Source

    E.Coli

    Formulation

    HTNV is formulated in 1XPBS.

    Purity

    HTNV protein is >90% pure as determined by SDS PAGE.

    More Info

    • Synonyms

      HTNV, Hantaan Virus, Hantanvirus.

    • Physical Appearance

      Sterile filtered colorless solution.

    • Stability

      Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles.

    • Background

      What is the source or expression system of Hantavirus- Nucleocapsid Protein?
      Escherichia Coli.

      What is the Purity of Hantavirus- Nucleocapsid Protein?
      Hantavirus- Nucleocapsid Protein is >90% pure as determined by SDS-PAGE.

      What is the molecular weight / Mw of Hantavirus- Nucleocapsid Protein?
      Hantavirus- Nucleocapsid Protein having a total Mw of 23.8kDa.

      Is Hantavirus- Nucleocapsid conjugated to a Tag?
      Hantavirus- Nucleocapsid is fused to 6xHis Tag at N-terminal.

      What is the Biological Activity of Hantavirus- Nucleocapsid Protein?
      The biological functionality of Hantavirus- Nucleocapsid Protein will be determined in the future.

      What is the endotoxin level for Hantavirus- Nucleocapsid Protein?
      The endotoxin level is minimal, Hantavirus- Nucleocapsid Protein was purified using conventional chromatography techniques.

      What is the amino acid sequence of Hantavirus- Nucleocapsid Protein?
      Hantavirus- Nucleocapsid Protein is composed from 1-200 amino acids.

      What applications can Hantavirus- Nucleocapsid Protein be used in?
      Hantavirus-Nucleocapsid Protein can probably be used in western blot, ELISA and Lateral Flow.

      What is the function of the hantavirus nucleocapsid (N) protein?
      The hantavirus nucleocapsid (N) protein surrounds the viral RNA binding site and protects it during viral replication and assembly.

      Why is hantavirus nucleocapsid protein commonly used in ELISA assays?
      The hantavirus N protein is highly immunogenic, conserved and widely expressed and induces a strong antibody response in infected individuals.

      Does hantavirus N protein bind RNA?
      Hantavirus N protein contains RNA-binding domains that specifically interact with viral genomic

      Is the hantavirus nucleocapsid protein suitable for antibody production?
      Resulting from high immunogenicity, recombinant hantavirus N protein is highly used as an immunogen for generating both polyclonal and monoclonal antibodies.

    • Purification Method

      Purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hantavirus Protein
  • View Data Sheet

    Name :

    HTNV

    Description:

    Hantavirus Recombinant

    HTNV, Hantaan Virus, Hantanvirus.

    Product # :

    HTV-001

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The Hantavirus nucleocapsid (N) fusion protein is expressed in E. coli and is fused to 6xHis tag. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.

    Source

    E.Coli

    Formulation

    HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.

    Purity

    HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining).

    More Info

    • Synonyms

      HTNV, Hantaan Virus, Hantanvirus.

    • Physical Appearance

      Sterile filtered colorless solution.

    • Stability

      Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles.

    • Amino Acid Sequence

      GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD

    • Background

      What is the source or expression system of Hantavirus- Nucleocapsid Protein?
      Escherichia Coli.

      What is the Purity of Hantavirus- Nucleocapsid Protein?
      Hantavirus- Nucleocapsid Protein is >95% pure as determined by SDS-PAGE.

      Is Hantavirus- Nucleocapsid conjugated to a Tag?
      Hantavirus- Nucleocapsid is fused to 6xHis.

      What is the Biological Activity of Hantavirus- Nucleocapsid Protein?
      The biological functionality of Hantavirus- Nucleocapsid Protein will be determined in the future.

      What is the endotoxin level for Hantavirus- Nucleocapsid Protein?
      The endotoxin level is minimal, Hantavirus- Nucleocapsid Protein was purified using conventional chromatography techniques.

      What applications can Hantavirus- Nucleocapsid Protein be used in?
      Hantavirus-Nucleocapsid Protein can probably be used in Immunoassay.

      What is the function of the hantavirus nucleocapsid (N) protein?
      The hantavirus nucleocapsid (N) protein surrounds the viral RNA binding site and protects it during viral replication and assembly.

      Why is hantavirus nucleocapsid protein commonly used in ELISA assays?
      The hantavirus N protein is highly immunogenic, conserved and widely expressed and induces a strong antibody response in infected individuals.

      Does hantavirus N protein bind RNA?
      Hantavirus N protein contains RNA-binding domains that specifically interact with viral genomic

      Is the hantavirus nucleocapsid protein suitable for antibody production?
      Resulting from high immunogenicity, recombinant hantavirus N protein is highly used as an immunogen for generating both polyclonal and monoclonal antibodies.

    • Purification Method

      Purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hantavirus Protein

Hantaviruses is part of the Bunyaviridae family of viruses. Hantaviruses are transmitted by aerosolized rodent excretia or rodent bites. The infection of Hantavirus is called hemorrhagic fever with renal syndrome relating with high mortality.
What is the Hantavirus nucleocapsid (N) protein?
The nucleocapsid (N) protein is the most important structural protein of Hantaviruses. It binds the viral RNA genome, forming the ribonucleoprotein complex required for viral replication.
 Why is Hantavirus N protein commonly used in ELISA assays?
The N protein is highly immunogenic and induces a strong antibody response during infection therefore, antibodies against N protein can be detected early.
What are the functions of the Hantavirus glycoproteins Gn and Gc?
Gn and Gc are located on the viral surface and mediate attachment to host cells. Together, they are needed for infection and are major targets of neutralizing antibodies.
Which Hantavirus proteins are used for vaccine development?
Most vaccine research focuses on the glycoproteins Gn and Gc since they induce neutralizing antibodies capable of blocking infection.
Which Hantavirus protein is most immunogenic?
The nucleocapsid (N) protein is considered the most immunogenic Hantavirus protein.
Can recombinant Hantavirus proteins be used safely in research?
Yes, since recombinant Hantavirus proteins do not contain infectious viral particles and are commonly used in standard laboratory settings.
What is the best Hantavirus protein for diagnostic test development?
For assays such as ELISA, the nucleocapsid (N) protein is generally the preferred antigen.