Search results

What is the molecular weight/Mw of THYMOSIN BETA 4 Protein?
THYMOSIN BETA 4 Protein has a total Mw of 4.96kDa.

What is the Purity of THYMOSIN BETA 4 Protein?
THYMOSIN BETA 4 Protein is >98% pure as determined by SDS-PAGE.

What is the Biological Activity of THYMOSIN BETA 4 Protein?
The biological functionality of THYMOSIN BETA 4 Protein will be determined in the future.

What is the amino acid sequence of THYMOSIN BETA 4 Protein?
Thymosin b4 has an a.a. sequence of Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH.
What applications can THYMOSIN BETA 4 Protein be used in?
THYMOSIN BETA 4 Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for THYMOSIN BETA 4 Protein?
The endotoxin level is minimal, THYMOSIN BETA 4 Protein was purified using conventional chromatography techniques.

Who supplies THYMOSIN BETA 4 that is in stock and available to order?
ProSpec has the protein in stock and available for immediate delivery.

Where can I order bulk mg quantities of THYMOSIN BETA 4?
ProSpec supplies bulk mg quantities at affordable prices that meets research and academic budgets.

PNC-27, a promising anticancer peptide, has gained attention due to its selective cytotoxicity against cancer cells without harming normal cells. This paper aims to elucidate the biochemical characteristics of PNC-27 and explore its potential therapeutic applications in the field of oncology.

PNC-27, a novel anticancer peptide, holds great promise in the treatment of cancer due to its unique mechanism of action and selective cytotoxicity towards cancer cells (Goldberg et al., 2010). This paper seeks to delve into the biochemical attributes of PNC-27 and its therapeutic potential in cancer treatment.

Derived from the p53 tumor-suppressor protein, PNC-27 exhibits a unique binding affinity for the MDM-2 protein found in the membranes of cancer cells. This binding triggers membrane pore formation, leading to cell lysis and death, leaving normal cells unaffected (Goldberg et al., 2010).

Preclinical studies have highlighted the potential of PNC-27 in treating various types of cancers. Its ability to induce cell death in cancer cells without harming normal cells presents a promising direction for cancer therapeutics. For instance, studies have shown PNC-27 to be effective against lung and breast cancers (Hoshino et al., 2011; Sarafraz-Yazdi et al., 2010).

The promising potential of PNC-27 warrants further exploration in clinical trials to evaluate its efficacy and safety in humans. Furthermore, investigation into its synergistic effects with other cancer treatments could provide a more holistic approach to cancer therapeutics. In conclusion, PNC-27 presents an exciting avenue for cancer research, offering a novel and targeted approach to cancer treatment.

Delta Sleep-Inducing Peptide (DSIP), also known as Sleep-Promoting Peptide, is a neuropeptide that has been the subject of extensive research due to its potential role in sleep regulation, stress response, and neuroprotection. This nonapeptide, first isolated from the cerebral venous blood of rabbits during sleep, has been shown to induce slow-wave sleep, modulate pain perception, and exhibit potential antioxidant and immunomodulatory properties.

DSIP's primary function is its interaction with the sleep regulatory system. By modulating the release of certain neurotransmitters, DSIP can influence sleep patterns, particularly promoting slow-wave sleep, the most restorative stage of sleep. Studies by Kovalzon et al. (2011) have demonstrated that DSIP can enhance sleep quality in rats, suggesting potential applications in sleep disorders and the promotion of healthy sleep patterns.

In addition to its sleep-inducing effects, DSIP has been shown to possess neuroprotective properties. Research by Zolotarev et al. (2014) found that DSIP could protect neurons from oxidative stress, suggesting potential applications in the treatment of neurodegenerative diseases such as Alzheimer's and Parkinson's disease.

Given its sleep-inducing and neuroprotective effects, DSIP has been proposed as a potential therapeutic agent for a variety of conditions, including sleep disorders, chronic pain, and neurodegenerative diseases. For instance, a study by Spong et al. (2016) found that DSIP could improve sleep quality in patients with chronic insomnia, indicating its potential as a therapeutic agent in the treatment of sleep disorders.

While research on DSIP is promising, it is important to note that most studies have been conducted in animals or in vitro. More research is needed to fully understand the potential effects and applications of DSIP in humans. However, the existing body of research suggests that DSIP could be a promising tool in the treatment of sleep disorders, chronic pain, and neurodegenerative diseases.

Kisspeptin-10, a peptide derived from the Kisspeptin gene (KISS1), has emerged as a key player in the regulation of reproductive physiology. The peptide is known for its potent ability to stimulate the release of gonadotropin-releasing hormone (GnRH), a crucial factor in the control of the hypothalamic-pituitary-gonadal axis. The pivotal role of kisspeptin-10 in orchestrating the onset of puberty and the regulation of the menstrual cycle highlights its significance in reproductive health. This research aims to delve into the multifaceted functions of kisspeptin-10, shedding light on its physiological roles and potential applications in reproductive disorders.

The primary objective of this study is to comprehensively explore the effects of kisspeptin-10 on the reproductive system. In vitro and in vivo assays will be conducted to investigate the impact of kisspeptin-10 on GnRH release and subsequent gonadotropin secretion. The interactions between kisspeptin-10 and its receptor, G protein-coupled receptor 54 (GPR54), will be explored using binding assays, potentially unraveling novel signaling pathways activated by this interaction.

The second objective is to investigate the potential therapeutic applications of kisspeptin-10 in reproductive disorders. Clinical studies and animal models will be utilized to assess the efficacy of kisspeptin-10 in stimulating ovulation, particularly in cases of infertility caused by hypothalamic dysfunction. Furthermore, the potential of kisspeptin-10 in regulating conditions like polycystic ovary syndrome (PCOS) and hypogonadotropic hypogonadism will be explored.

The third objective is to elucidate the molecular mechanisms underlying the actions of kisspeptin-10. Transcriptomic and proteomic analyses will be employed to identify genes and proteins regulated by kisspeptin-10 stimulation. This information could reveal novel downstream effectors of kisspeptin-10 signaling, contributing to a more comprehensive understanding of its role in reproductive physiology.

By delving into the complexities of kisspeptin-10, this research aims to provide insights into its multifunctional roles in reproductive health and expand its potential therapeutic applications. The findings from this study may pave the way for the development of targeted interventions for reproductive disorders, potentially improving the quality of life for individuals affected by these conditions.

Tirzepatide is a first-in-class dual glucose-dependent insulinotropic polypeptide and glucagon-like peptide-1 receptor agonist. Recent development suggests Tirzepatide as organ protection and systemic metabolic health while at first, it was only approved for Type 2 Diabetes and Chronic Weight Management. Preclinical data also indicates a promising future in neuroprotection and most likely to expand its clinical utility into neurodegenerative pathologies.

What is the molecular weight/Mw of TIRZEPATIDE Protein?
TIRZEPATIDE Protein has a total Mw of 4.8kDa.

What is the Purity of TIRZEPATIDE Protein?
TIRZEPATIDE Protein is >97% pure as determined by SDS-PAGE.

What is the Biological Activity of TIRZEPATIDE Protein?
The biological functionality of TIRZEPATIDE Protein will be determined in the future.

What is the amino acid sequence of TIRZEPATIDE Protein?
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Aib-Leu-Asp-Lys-Ile-Ala-Gln-Lys (Eicosanedioyl-isoGlu-PEG2-PEG2)-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2.
What applications can TIRZEPATIDE Protein be used in?
TIRZEPATIDE Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for TIRZEPATIDE Protein?
The endotoxin level is minimal, TIRZEPATIDE Protein was purified using conventional chromatography techniques.

Who supplies TIRZEPATIDE that is in stock and available to order?
ProSpec has the protein in stock and available for immediate delivery.

Where can I order bulk mg quantities of TIRZEPATIDE?
ProSpec supplies bulk mg quantities at affordable prices that meets research and academic budgets.

What is the molecular weight/Mw of FOLLICLE STIMULATING HORMONE HUMAN Protein?
FOLLICLE STIMULATING HORMONE HUMAN Protein has a total Mw of 30kDa.

What is the source or expression system of FOLLICLE STIMULATING HORMONE HUMAN Protein?
Urine of post-menopausal women.

What is the Biological Activity of FOLLICLE STIMULATING HORMONE HUMAN Protein?
The biological functionality of FOLLICLE STIMULATING HORMONE HUMAN Protein will be determined in the future.

What is the amino acid sequence of FOLLICLE STIMULATING HORMONE HUMAN Protein?
FOLLICLE STIMULATING HORMONE HUMAN Protein is composed from 92 amino acids a chain and 111 amino acids b chain.

What applications can FOLLICLE STIMULATING HORMONE HUMAN Protein be used in?
FOLLICLE STIMULATING HORMONE HUMAN Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for FOLLICLE STIMULATING HORMONE HUMAN Protein?
The endotoxin level is minimal, FOLLICLE STIMULATING HORMONE HUMAN Protein was purified using conventional chromatography techniques.

What is the molecular weight/Mw of TRH HUMAN Protein?
TRH HUMAN Protein has a total Mw of 0.36kDa.

What is the Purity of TRH HUMAN Protein?
TRH HUMAN Protein is >98.2% pure as determined by SDS-PAGE.

What is the Biological Activity of TRH HUMAN Protein?
The biological functionality of TRH HUMAN Protein will be determined in the future.

What is the amino acid sequence of TRH HUMAN Protein?
Pyr-His-Pro-NH2.

What applications can TRH HUMAN Protein be used in?
TRH HUMAN Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for TRH HUMAN Protein?
The endotoxin level is minimal, TRH HUMAN Protein was purified using conventional chromatography techniques.

Cagrilintide plays a role as a pioneering long-acting amylin analogue and integrates into the fixed-dose combination CagriSema (Cagrilintide + Semaglutide). Unlike GLP-1 agonists, Cagrilintide mimics amylin, a hormone co-secreted with insulin takes part in regulating satiety and slows gastric emptying through brainstem pathways.

Ornipressin, a naturally occurring non-mammalian vasopressin analogue, has been recognized for its role in vasoconstriction and antidiuresis, making it an invaluable agent in certain clinical settings (Holmes et al., 2003). This paper aims to comprehensively review ornipressin's biochemical properties, its clinical applications, and potential future directions for therapeutic use.

Ornipressin is characterized by its strong vasopressin V1 receptor agonist activity, resulting in intense vasoconstriction. It also exhibits antidiuretic properties through the activation of V2 receptors in the renal collecting ducts, albeit to a lesser extent compared to vasopressin (Evans & Davidson, 1964).

Clinical applications of ornipressin are mainly driven by its potent vasoconstrictor activity. It has shown promise in managing esophageal variceal bleeding, where its vasoconstrictive properties help achieve hemostasis (Bosch et al., 2004).

Furthermore, it has been used as a rescue therapy in vasodilatory shock, where traditional vasoconstrictors may have limited effect (Morelli et al., 2005).
As our understanding of ornipressin continues to expand, future research is directed toward fine-tuning its application in various clinical scenarios and exploring potential new therapeutic roles. Current research is investigating the possible neuroprotective role of ornipressin in conditions such as cerebral ischemia (Uchida et al., 2010).

Ornipressin, with its robust vasoconstrictor and antidiuretic properties, plays a crucial role in managing certain clinical situations. As we continue to explore this intriguing compound, its therapeutic potential appears to be far-reaching, warranting continued research in this field

Semaglutide, a glucagon-like peptide-1 receptor agonist (GLP-1 RA), has emerged as a breakthrough in the field of diabetes management and metabolic disorders. It is recognized for its potent glucose-lowering effects, weight management properties, and cardiovascular benefits. Beyond diabetes, semaglutide is under investigation for its potential applications in obesity treatment and other related conditions. This research aims to comprehensively explore semaglutide, shedding light on its multifaceted mechanisms of action and its broader therapeutic implications.

The primary objective of this research is to elucidate the mechanisms underlying the glucose-lowering and metabolic effects of semaglutide. In vitro and in vivo experiments will be conducted to investigate how semaglutide interacts with GLP-1 receptors, influences insulin secretion, and modulates glucose homeostasis. Understanding these mechanisms is crucial for harnessing the full therapeutic potential of semaglutide.

The second objective is to assess the clinical relevance of semaglutide in diabetes management. Clinical trials involving individuals with type 2 diabetes will be conducted to evaluate the efficacy, safety, and long-term outcomes of semaglutide treatment. These investigations may provide valuable insights into its use as a monotherapy or adjunct therapy in diabetes care.

The third objective is to explore the potential applications of semaglutide beyond diabetes. Research will investigate its role in obesity treatment, cardiovascular risk reduction, and non-alcoholic fatty liver disease (NAFLD) management. Understanding the multifaceted properties of semaglutide may open new avenues for therapeutic interventions in various metabolic and cardiovascular conditions.

By delving into the diverse functions of semaglutide, this research aims to expand our understanding of its therapeutic potential and clinical applications. The findings may contribute to improved treatment strategies for individuals affected by diabetes, obesity, and related metabolic disorders.

What is the molecular weight/Mw of FOLLICLE STIMULATING HORMONE Protein?
FOLLICLE STIMULATING HORMONE Protein has a total Mw of 25kDa.

What is the source or expression system of FOLLICLE STIMULATING HORMONE Protein?
HEK293.

What is the Purity of FOLLICLE STIMULATING HORMONE Protein?
FOLLICLE STIMULATING HORMONE Protein is >95% pure as determined by SDS-PAGE.

What is the Biological Activity of FOLLICLE STIMULATING HORMONE Protein?
The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.

What is the amino acid sequence of FOLLICLE STIMULATING HORMONE Protein?
FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLR SKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS.
FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.

What applications can FOLLICLE STIMULATING HORMONE Protein be used in?
FOLLICLE STIMULATING HORMONE Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for FOLLICLE STIMULATING HORMONE Protein?
The endotoxin level is minimal, FOLLICLE STIMULATING HORMONE Protein was purified using conventional chromatography techniques.

Who supplies recombinant FOLLICLE STIMULATING HORMONE that is in stock and available to order?
ProSpec has the protein in stock and available for immediate delivery.

Where can I order bulk mg quantities of FOLLICLE STIMULATING HORMONE?
ProSpec supplies bulk mg quantities at affordable prices that meets research and academic budgets.