Skip to content

High-quality research proteins.

  • 1-800-805-6531

  • Mon - Sat 8.00-18.00, Sun - Closed

  • info@prospecbio.com

  • PO Box 6591 East Brunswick NJ 08816

  • Products
    • Cytokines
    • Growth factors
    • Chemokines
    • Cd antigens
    • Neurotrophins
    • Hormones
    • Enzymes
    • Viral antigens
    • Recombinant proteins
    • Natural proteins
    • Monoclonal antibodies
    • Polyclonal antibodies
    • Thermal Packaging
  • About
    • Company
    • Founder
    • Contribution
  • Customers
    • Eastern Asia
    • Eastern Europe
    • North America
    • South America
    • South East Asia
    • Southern Asia
    • Western Europe
  • Ordering
    • Ordering Method
    • Ordering - Credit Card
    • Ordering - PO
    • Shipping Fees
    • FAQs
  • Services
    • DNA Cloning
    • Protein Expression
    • Monoclonal Antibody
    • Fermentation
    • Technology License
  • Contact us
Log in

Country/region

  • USD $ | Albania
  • USD $ | Andorra
  • USD $ | Argentina
  • USD $ | Armenia
  • USD $ | Australia
  • USD $ | Austria
  • USD $ | Azerbaijan
  • USD $ | Belarus
  • USD $ | Belgium
  • USD $ | Bolivia
  • USD $ | Brazil
  • USD $ | Bulgaria
  • USD $ | Cambodia
  • USD $ | Canada
  • USD $ | Chile
  • USD $ | China
  • USD $ | Colombia
  • USD $ | Costa Rica
  • USD $ | Croatia
  • USD $ | Cyprus
  • USD $ | Czechia
  • USD $ | Denmark
  • USD $ | Estonia
  • USD $ | Finland
  • USD $ | France
  • USD $ | Georgia
  • USD $ | Germany
  • USD $ | Greece
  • USD $ | Hong Kong SAR
  • USD $ | Hungary
  • USD $ | Iceland
  • USD $ | India
  • USD $ | Ireland
  • USD $ | Israel
  • USD $ | Italy
  • USD $ | Japan
  • USD $ | Kazakhstan
  • USD $ | Latvia
  • USD $ | Liechtenstein
  • USD $ | Lithuania
  • USD $ | Madagascar
  • USD $ | Malta
  • USD $ | Mexico
  • USD $ | Moldova
  • USD $ | Monaco
  • USD $ | Netherlands
  • USD $ | New Zealand
  • USD $ | North Macedonia
  • USD $ | Norway
  • USD $ | Panama
  • USD $ | Paraguay
  • USD $ | Peru
  • USD $ | Philippines
  • USD $ | Poland
  • USD $ | Portugal
  • USD $ | Romania
  • USD $ | Singapore
  • USD $ | Slovakia
  • USD $ | Slovenia
  • USD $ | South Africa
  • USD $ | South Korea
  • USD $ | Spain
  • USD $ | Sri Lanka
  • USD $ | Sweden
  • USD $ | Switzerland
  • USD $ | Taiwan
  • USD $ | Thailand
  • USD $ | Türkiye
  • USD $ | Ukraine
  • USD $ | United Kingdom
  • USD $ | United States
  • USD $ | Uruguay
  • USD $ | Vatican City
  • USD $ | Venezuela
  • USD $ | Vietnam
  • Facebook
  • Instagram
logoProSpec - Recombinant Protein Manufacturer for academic and R&D industry
Become a distributor
Account Log in
Wishlist
Cart Cart(0)
  • Products
    +
    • Cytokines
    • Growth factors
    • Chemokines
    • Cd antigens
    • Neurotrophins
    • Hormones
    • Enzymes
    • Viral antigens
    • Recombinant proteins
    • Natural proteins
    • Monoclonal antibodies
    • Polyclonal antibodies
    • Thermal Packaging
  • About
    +
    • Company
    • Founder
    • Contribution
  • Customers
    +
    • Eastern Asia
    • Eastern Europe
    • North America
    • South America
    • South East Asia
    • Southern Asia
    • Western Europe
  • Ordering
    +
    • Ordering Method
    • Ordering - Credit Card
    • Ordering - PO
    • Shipping Fees
    • FAQs
  • Services
    +
    • DNA Cloning
    • Protein Expression
    • Monoclonal Antibody
    • Fermentation
    • Technology License
  • Contact us

Item added to your cart

View cart
View All
  • Cytokines
  • Growth factors
  • Chemokines
  • Cd antigens
  • Neurotrophins
  • Hormones
  • Enzymes
  • Viral antigens
  • Recombinant proteins
  • Natural proteins
  • Monoclonal antibodies
  • Polyclonal antibodies
  • Thermal Packaging
  • Tumor Necrosis Factor

    Tumor Necrosis Factor

    View All
  • 4-1BB

    4-1BB

    View All
  • Adiponectin

    Adiponectin

    View All
  • AIF1

    AIF1

    View All
  • Other Cytokines

    Other Cytokines

    View All
  • AITRL

    AITRL

    View All
  • Angiopoietin

    Angiopoietin

    View All
  • Apolipoprotein

    Apolipoprotein

    View All
  • B-Cell Activating Factor

    B-Cell Activating Factor

    View All
  • Beta Defensin

    Beta Defensin

    View All
  • Bone Morphogenetic Protein

    Bone Morphogenetic Protein

    View All
  • B type Natriuretic Peptide

    B type Natriuretic Peptide

    View All
  • BST

    BST

    View All
  • Betacellulin

    Betacellulin

    View All
  • Cardiotrophin

    Cardiotrophin

    View All
  • Activin

    Activin

    View All
  • Fibroblast Growth Factor

    Fibroblast Growth Factor

    View All
  • Other Growth Factors

    Other Growth Factors

    View All
  • CSF

    CSF

    View All
  • CTGF

    CTGF

    View All
  • IGFBP

    IGFBP

    View All
  • VEGF Protein

    VEGF Protein

    View All
  • EGF

    EGF

    View All
  • Epigen

    Epigen

    View All
  • Erythropoietin

    Erythropoietin

    View All
  • Insulin-Like Growth Factor

    Insulin-Like Growth Factor

    View All
  • Growth Hormone

    Growth Hormone

    View All
  • HDGF

    HDGF

    View All
  • Hepatocyte Growth Factor

    Hepatocyte Growth Factor

    View All
  • Insulin

    Insulin

    View All
  • BCA-1/ BLC (CXCL13)

    BCA-1/ BLC (CXCL13)

    View All
  • BRAK (CXCL14)

    BRAK (CXCL14)

    View All
  • C-10 (CCL6)

    C-10 (CCL6)

    View All
  • Other Chemokines

    Other Chemokines

    View All
  • MEC (CCL28)

    MEC (CCL28)

    View All
  • LD78-beta (CCL3L1)

    LD78-beta (CCL3L1)

    View All
  • CTACK (CCL27)

    CTACK (CCL27)

    View All
  • CXCL16

    CXCL16

    View All
  • CXCL17

    CXCL17

    View All
  • Platelet Factor-4 (CXCL4)

    Platelet Factor-4 (CXCL4)

    View All
  • ENA-78 (CXCL5)

    ENA-78 (CXCL5)

    View All
  • Eotaxin (CCL11,24,26)

    Eotaxin (CCL11,24,26)

    View All
  • Exodus-2 (CCL21)

    Exodus-2 (CCL21)

    View All
  • Fractalkine (CX3CL1)

    Fractalkine (CX3CL1)

    View All
  • CXCL6

    CXCL6

    View All
  • Other CD Antigens

    Other CD Antigens

    View All
  • CD14

    CD14

    View All
  • CD164

    CD164

    View All
  • CD1

    CD1

    View All
  • CD2

    CD2

    View All
  • CD200

    CD200

    View All
  • CD207

    CD207

    View All
  • CD226

    CD226

    View All
  • CD23

    CD23

    View All
  • CD244

    CD244

    View All
  • CD247

    CD247

    View All
  • CD27

    CD27

    View All
  • CD274

    CD274

    View All
  • CD300

    CD300

    View All
  • CD33

    CD33

    View All
  • Other Neurotrophins

    Other Neurotrophins

    View All
  • Beta-NGF

    Beta-NGF

    View All
  • BDNF

    BDNF

    View All
  • CDNF

    CDNF

    View All
  • CNTF

    CNTF

    View All
  • GDNF

    GDNF

    View All
  • Glia Maturation Factor

    Glia Maturation Factor

    View All
  • MANF

    MANF

    View All
  • Midkine

    Midkine

    View All
  • Neuroglobin

    Neuroglobin

    View All
  • Neurotrophic factors

    Neurotrophic factors

    View All
  • Neuregulin

    Neuregulin

    View All
  • Neuropilin

    Neuropilin

    View All
  • Pigment Epithelium-Derived Factor

    Pigment Epithelium-Derived Factor

    View All
  • Pleiotrophin

    Pleiotrophin

    View All
  • Peptide Hormones

    Peptide Hormones

    View All
  • Other Hormones

    Other Hormones

    View All
  • HCG

    HCG

    View All
  • Endothelin

    Endothelin

    View All
  • Exendin

    Exendin

    View All
  • FSH

    FSH

    View All
  • Glucagon

    Glucagon

    View All
  • GHRP

    GHRP

    View All
  • GLP

    GLP

    View All
  • Thyrostimulin

    Thyrostimulin

    View All
  • Inhibin A

    Inhibin A

    View All
  • LHRH

    LHRH

    View All
  • Melanotan

    Melanotan

    View All
  • Procalcitonin

    Procalcitonin

    View All
  • PTH

    PTH

    View All
  • Peroxiredoxin

    Peroxiredoxin

    View All
  • Peptidase

    Peptidase

    View All
  • Synthetase

    Synthetase

    View All
  • Transferase

    Transferase

    View All
  • Hydrolase

    Hydrolase

    View All
  • Dehydrogenase

    Dehydrogenase

    View All
  • ACE2

    ACE2

    View All
  • Esterase

    Esterase

    View All
  • Protein Kinases

    Protein Kinases

    View All
  • Other Enzymes

    Other Enzymes

    View All
  • Phosphatase

    Phosphatase

    View All
  • Deaminase

    Deaminase

    View All
  • Oxygenase

    Oxygenase

    View All
  • Adenylate Kinase

    Adenylate Kinase

    View All
  • Lyase

    Lyase

    View All
  • Chagas

    Chagas

    View All
  • SARS

    SARS

    View All
  • Influenza

    Influenza

    View All
  • ASFV

    ASFV

    View All
  • Astrovirus

    Astrovirus

    View All
  • Borrelia

    Borrelia

    View All
  • Helicobacter Pylori

    Helicobacter Pylori

    View All
  • Chikungunya

    Chikungunya

    View All
  • Chlamydia

    Chlamydia

    View All
  • Cytomegalo

    Cytomegalo

    View All
  • Dengue

    Dengue

    View All
  • EBV

    EBV

    View All
  • Ebola

    Ebola

    View All
  • Feline Leukemia Virus

    Feline Leukemia Virus

    View All
  • Hepatitis A

    Hepatitis A

    View All
  • Other

    Other

    View All
  • Actin

    Actin

    View All
  • ADAM

    ADAM

    View All
  • Complement Component

    Complement Component

    View All
  • Ag85

    Ag85

    View All
  • Eukaryotic Translation Initiation Factor

    Eukaryotic Translation Initiation Factor

    View All
  • Anterior Gradient Protein

    Anterior Gradient Protein

    View All
  • Heat Shock Protein

    Heat Shock Protein

    View All
  • Alpha-2-HS-Glycoprotein

    Alpha-2-HS-Glycoprotein

    View All
  • Hemoglobin

    Hemoglobin

    View All
  • Allergy

    Allergy

    View All
  • Anaplasma

    Anaplasma

    View All
  • Angiogenin

    Angiogenin

    View All
  • Ankyrin Repeat Domain

    Ankyrin Repeat Domain

    View All
  • Annexin

    Annexin

    View All
  • Other Natural Proteins

    Other Natural Proteins

    View All
  • Aprotinin

    Aprotinin

    View All
  • Transferrin

    Transferrin

    View All
  • Avidin

    Avidin

    View All
  • Anti Coagulation Factors

    Anti Coagulation Factors

    View All
  • Natural Albumin

    Natural Albumin

    View All
  • Natural Coagulation Factors

    Natural Coagulation Factors

    View All
  • Fibronectin

    Fibronectin

    View All
  • Thrombin

    Thrombin

    View All
  • Anti Human Enzyme

    Anti Human Enzyme

    View All
  • Other Monoclonal Antibodies

    Other Monoclonal Antibodies

    View All
  • Anti Human Cytokine

    Anti Human Cytokine

    View All
  • Anti Human Heat Shock Protein

    Anti Human Heat Shock Protein

    View All
  • Anti Mouse Lymphocyte

    Anti Mouse Lymphocyte

    View All
  • Anti Human Chemokine

    Anti Human Chemokine

    View All
  • Anti Human Lymphocyte

    Anti Human Lymphocyte

    View All
  • Anti Viral Monoclonal

    Anti Viral Monoclonal

    View All
  • Anti Mouse Cytokine

    Anti Mouse Cytokine

    View All
  • Anti-GST Monoclonal

    Anti-GST Monoclonal

    View All
  • Other Polyclonal Antibodies

    Other Polyclonal Antibodies

    View All
  • Anti Viral

    Anti Viral

    View All
  • Anti-GST Monoclonal

    Anti-GST Monoclonal

    View All
Back

Search results

1000 results found for “Anti-GST Monoclonal”

Name

Description

Product #

Price

Quantity

Shipping Method

  • View Data Sheet

    Name :

    PRDX1 Antibody

    Description:

    Peroxiredoxin-1, Mouse Anti Human

    Peroxiredoxin-1, EC 1.11.1.15, Thioredoxin peroxidase 2, Thioredoxin-dependent peroxide reductase 2, Proliferation-associated gene protein, Natural killer cell-enhancing factor A, NKEF-A, PRDX1, TDPX2, PRDX-1, PAG, PAGA, PRX1, PAGB, PRXI, MSP23, NKEFA.

    Product # :

    ANT-394

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.

    More Info

    • Introduction

      PRDX1 is part of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. PRDX1 is an important protector of red blood cells against reactive oxygen species and in tumor prevention. PRDX1 is antioxidant protective in cells, and contributes to the antiviral activity of CD8(+) T-cells. PRDX1 has a proliferative effect and is involved in cancer development or progression. Peroxiredoxin-1 is plays a role in redox regulation of the cell. Peroxiredoxin decreases peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. Peroxiredoxin is involved in eliminating peroxides generated during metabolism. Peroxiredoxin participates in the signaling cascades of growth factors and TNF-alpha by regulating the intracellular concentrations of h(2)o(2).

    • Synonyms

      Peroxiredoxin-1, EC 1.11.1.15, Thioredoxin peroxidase 2, Thioredoxin-dependent peroxide reductase 2, Proliferation-associated gene protein, Natural killer cell-enhancing factor A, NKEF-A, PRDX1, TDPX2, PRDX-1, PAG, PAGA, PRX1, PAGB, PRXI, MSP23, NKEFA.

    • Immunogen

      Anti-human PRDX1 mAb is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human PRDX1 amino acids 1-199 purified from E. coli.

    • Ig Subclass

      Mouse IgG1 heavy chain and κ light chain.

    • Clone

      PAT1D8AT.

    • Applications

      PRDX1 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:1000 ~ 2000. Recommended starting dilution is 1:1000.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      PRDX1 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Prdx1 Antibody
  • View Data Sheet

    Name :

    Activin-A Antibody

    Description:

    Activin-A, Polyclonal Rabbit Anti-Human Antibody

    Inhba, Inhibin beta A, FSH releasing protein.

    Product # :

    ANT-029

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.

    More Info

    • Introduction

      Activins are homodimers or heterodimers of the different β subunit isoforms, part of the TGFβ family. Mature Activin A has two 116 amino acids residues βA subunits (βA-βA). Activin displays an extensive variety of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins takes part in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Cells that are identified to express Activin A include fibroblasts, endothelial cells, hepatocytes, vascular smooth muscle cells, macrophages, keratinocytes, osteoclasts, bone marrow monocytes, prostatic epithelium, neurons, chondrocytes, osteoblasts, Leydig cells, Sertoli cells, and ovarian granulosa cells.

    • Synonyms

      Inhba, Inhibin beta A, FSH releasing protein.

    • Physical Appearance

      Sterile Filtered White lyophilized (freeze-dried) powder.

    • Stability

      Store at -20ºC. For long term storage freezes in working aliquots at -20ºC. Repeated freezing and thawing is not recommended.

    • Solubility

      Add 0.1 ml of distilled water and let the lyophilized pellet dissolve completely.

    • Immunogen

      Recombinant human Activin-A produced in plants.

    • Applications

      Activin-A antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. In order to detect Human Activin A by indirect ELISA a dilution of at least 1:1,000 of the Activin A antibody is required. Activin A antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of Human Activin A. In order to detect human Activin A by WB analysis this IgG can be used in a dilution of 1:1,000.

    • Neutralization

      To yield one-half maximal inhibition (ND50) of the biological activity of Activin A (7.5ng/ml), a concentration of 60-200ng/ml of the Activin-A antibody is required.

    • Type

      Polyclonal Rabbit Antibody.

    • Purification Method

      Purified IgG prepared by affinity chromatography on protein G.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Activin A Antibody
  • View Data Sheet

    Name :

    CD21 Antibody, FITC

    Description:

    CD21, Mouse Anti-Human, FITC

    Complement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB9.

    Product # :

    ANT-259

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml in PBS (after reconstitution).

    More Info

    • Introduction

      CD21 is expressed strongly on mature B cells, follicular dentritic cells and weakly on immature thymocytes and T lymphocytes. In B-cell ontogeny, CD21 appears after the pre-B-stage, is maintained during peripheral B-cell development and is lost upon terminal differentiation into plasma cells. CD21 expression is also gradually lost after stimulation of B cells in vitro. CD21 functions as receptor for C3d, C3dg and iC3b Complement components, for EBV and for IFNalpha. CD21 binds to CD23 and associates with CD19, CD81 and Leu13 to form a large signal-transduction complex involved in B cell activation.

    • Synonyms

      Complement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB9.

    • Solubility

      Reconstitute with of H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.

    • Immunogen

      Purified human B-Cells.

    • Ig Subclass

      Mouse IgG2a.

    • Clone

      hCD21.

    • Applications

      Staining antibody. For staining, use 10µl/1,000,000 cells.

    • Available Conjugates

      This antibody is also available unconjugated and Biotin. For staining with biotin or FITC-conjugated antibody use 5-10µl/106 cells.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      Lyophilized: store at 4°C. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.

    • Purification Method

      Protein-A.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Cd21 Antibody Fitc
  • View Data Sheet

    Name :

    CBR3 Antibody

    Description:

    Carbonyl Reductase-3, Mouse Anti Human

    Carbonyl reductase [NADPH] 3, NADPH-dependent carbonyl reductase 3, CBR3, carbonyl reductase 3, hCBR3, SDR21C2.

    Product # :

    ANT-393

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.

    More Info

    • Introduction

      CBR3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. CBR3 is one of several monomeric NADPH-dependent oxidoreductases. Furthermore, CBR3 contains 3 exons spanning 11.2 kilobases and is strongly linked to another carbonyl reductase gene, the CBR1. It was suggested that CBR3 mediates 9-cis-retinoic acid-induced cytostatis and is a potential prognostic marker for oral malignancy. CBR3 is identified in the ovary, pancreas, intestine, colon, kidney, brain, thymus, lung, heart, liver, spleen, leukocyte, prostate and the testis. Polymorphisms in CBR3 may give an explanation to interindividual and interethnic variability of doxorubicin pharmacokinetics and pharmacodynamics.

    • Synonyms

      Carbonyl reductase [NADPH] 3, NADPH-dependent carbonyl reductase 3, CBR3, carbonyl reductase 3, hCBR3, SDR21C2.

    • Immunogen

      Anti-human CBR3 mAb is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human CBR3 amino acids 1-277 purified from E. coli.

    • Ig Subclass

      Mouse IgG2b heavy chain and ? light chain.

    • Clone

      PAT7E8AT.

    • Applications

      CBR3 antibody has been tested by ELISA, Western blot analysis, Flow cytometry and ICC/IF to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      CBR3 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Cbr3 Antibody
  • View Data Sheet

    Name :

    GSTA1 Human

    Description:

    Glutathione S-Transferase Alpha-1 Human Recombinant

    GST2, GSTA1-1, GTH1, GSTA-1, GSTAI, GSTA-I, EC 2.5.1.18, Glutathione S-transferase A1, GST HA subunit 1, GST-epsilon, GST class-alpha member 1, GSTA1, MGC131939.

    Product # :

    ENZ-469

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • biological activity
    • More Info

    Description

    GSTA1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 222 amino acids (1-222 a.a.) and having a molecular mass of 25.6 kDa. The GSTA1 is purified by proprietary chromatographic techniques.

    Source

    Escherichia Coli.

    Formulation

    The GSTA1 solution (1mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 1mM DTT and 10% glycerol.

    Purity

    Greater than 90.0% as determined by SDS-PAGE.

    Biological Activity

    Specific activity is 35,000 pmol/min/ug, and is defined as the amount of enzyme that conjugate 1.0 u mole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.

    More Info

    • Introduction

      Membrane-bound & Cytosolic forms of GST are encoded by 2 separate supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. There are 8 different classes of soluble cytoplasmic mammalian GST: alpha, kappa, mu, omega, pi, sigma, theta and zeta. The GSTA1 is found in a cluster mapped to chromosome 6, and is highly expressed in the liver. GSTA1 protects the cells from reactive oxygen species.

    • Synonyms

      GST2, GSTA1-1, GTH1, GSTA-1, GSTAI, GSTA-I, EC 2.5.1.18, Glutathione S-transferase A1, GST HA subunit 1, GST-epsilon, GST class-alpha member 1, GSTA1, MGC131939.

    • Physical Appearance

      Sterile Filtered colorless solution.

    • Stability

      Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

    • Amino Acid Sequence

      MAEKPKLHYF NARGRMESTR WLLAAAGVEF EEKFIKSAED LDKLRNDGYL MFQQVPMVEI DGMKLVQTRA ILNYIASKYN LYGKDIKERA LIDMYIEGIA DLGEMILLLP VCPPEEKDAK LALIKEKIKN RYFPAFEKVL KSHGQDYLVG NKLSRADIHL VELLYYVEEL DSSLISSFPL LKALKTRISN LPTVKKFLQP GSPRKPPMDE KSLEEARKIF RF.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Gsta1 Human
  • View Data Sheet

    Name :

    CD90 Thy-1 Antibody

    Description:

    Thy-1 (CD90), Rat Anti-Mouse

    CD-90, CD90, THY-1, THY1, Theta Antigen.

    Product # :

    ANT-142

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml in PBS (after reconstitution).

    More Info

    • Introduction

      CD-90 plays a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
      Thy-1 is the designation for a major cell surface glycoprotein characteristic to T cells,. The Thy-1 glycoproteins are constituents of thymocytes and neurons and probably are involved in cell-cell interactions. Human Thy-1 homolog maps to chromosome 11 because that is where T3D is found, in the mouse T3D and Thy-1 map to chromosome 9 along with certain other loci that are on human 11q.

    • Synonyms

      CD-90, CD90, THY-1, THY1, Theta Antigen.

    • Solubility

      Reconstitute with H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.

    • Immunogen

      Purified mouse LN T cells.

    • Ig Subclass

      Rat IgG1.

    • Clone

      mThy-1.

    • Applications

      Cytotoxic and staining antibody. For staining, use 10µl/1,000,000 cells. This antibody is extremely efficient for killing in vivo. Exact titer for cytotoxicity should be determined by the investigator.

    • Available Conjugates

      This antibody is only available as purified antibody.

    • Type

      Rat Anti Mouse Monoclonal.

    • Storage Procedures

      Lyophilized: store at 4oC. After reconstitution, if not intended for use within a month, aliquot and store at -20oC.

    • Purification Method

      Ion exchange column.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Cd90 Thy 1 Antibody
  • View Data Sheet

    Name :

    NCL Human

    Description:

    Nucleolin Human Recombinant

    Nucleolin, Protein C23, NCL, C23.

    Product # :

    PRO-1508

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    Nucleolin Human Recombinant produced in SF9 is a glycosylated, polypeptide chain containing the C-terminal section of the human nucleolin and missing the N-terminal histone-binding part of nucleolin, having a calculated molecular mass of 55,162 Dalton. NCL is expressed with a -6x His tag at N-terminus and purified by proprietary chromatographic techniques.

    Source

    Sf9 Insect Cells.

    Formulation

    NCL is supplied in 20mM HEPES pH-7.3, 600mM NaCl, 0.3mM Tris(2-carboxyethyl)phosphine (TCEP) and 25% glycerol.

    Purity

    Greater than 80.0% as determined by SDS-PAGE.

    More Info

    • Introduction

      Nucleolin (NCL) which is a eukaryotic nucleolar phosphoprotein, involved in the synthesis and maturation of ribosomes. Nucleolin is the key nucleolar protein of growing eukaryotic cells. NCL is found linked with intranucleolar chromatin and pre-ribosomal particles. NCL induces chromatin decondensation by binding to histone H1. Nucleolin is assumed to have a role in pre-rRNA transcription and ribosome compilation. Nucleolin may also have a role in the process of transcriptional elongation. Nucleolin is located primarily in the dense fibrillar regions of the nucleolus. The Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb.

    • Synonyms

      Nucleolin, Protein C23, NCL, C23.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Ncl Human
  • View Data Sheet

    Name :

    VAMP2 Antibody

    Description:

    Synaptobrevin-2, Mouse Anti Human

    Vesicle-associated membrane protein 2, SYB2, VAMP-2, Synaptobrevin-2, VAMP2, FLJ11460.

    Product # :

    ANT-334

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.

    More Info

    • Introduction

      Synaptobrevin 2 which is an 18 kDa integral membrane protein localized to the cytoplasmic surface of synaptic vesicle, consists of a proline-rich N-terminal region, a highly conserved hydrophilic domain, followed by a transmembrane anchor and a C-terminal. Synaptobrevin 2 is predominantly expressed in Langerhans islets and glomerular cells. The N-terminal domain of the protein (residues 1-89) forms a specific SNARE complex with the target membrane-associated t- or Q-SNAREs syntaxin 1 and SNAP-25.

    • Synonyms

      Vesicle-associated membrane protein 2, SYB2, VAMP-2, Synaptobrevin-2, VAMP2, FLJ11460.

    • Immunogen

      Anti-human VAMP2 mAb is derived from hybridization of mouse SP2/O myeloma cells with spleen cells from BALB/c mice immunized with recombinant human VAMP2 amino acids 1-89 purified from E. coli.

    • Ig Subclass

      Mouse IgG1 heavy chain and κ light chain.

    • Clone

      P3E5AT.

    • Applications

      VAMP2 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:1,000 ~ 3,000. Recommended starting dilution is 1:2,000.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      VAMP2 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Vamp2 Antibody
  • View Data Sheet

    Name :

    Streptavidin

    Description:

    Streptavidin Recombinant

    Product # :

    PRO-791

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa.

    Source

    Escherichia Coli.

    Formulation

    Lyophilized in 10mM potassium phosphate buffer pH 6.5.

    Purity

    Greater than 98.0% as determined by SDS-PAGE and HPLC.

    More Info

    • Introduction

      Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.

    • Physical Appearance

      Sterile Filtered White lyophilized (freeze-dried) powder.

    • Stability

      Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.

    • Solubility

      It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H2O not less than 0.5mg/ml, which can then be further diluted to other aqueous solutions.

    • Amino Acid Sequence

      MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLT
      GRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGA
      EARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

    • Proteolytic Activity

      < 10-3 U/mg protein (Azocoll, 25 °C, 24 h, pH 8.0).

    • Specific Activity

      > 17U/mg (one unit binds 1 μg D-biotin).

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Streptavidin Recombinant
  • View Data Sheet

    Name :

    HK1 Antibody

    Description:

    Hexokinase-1, Mouse Anti Human

    Hexokinase-1, EC 2.7.1.1, Hexokinase type I, HK I, Brain form hexokinase, HK1-ta, HK1-tb, HXK1, HK1.

    Product # :

    ANT-375

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.

    More Info

    • Introduction

      Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. Hexokinase1 encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of HXK1 results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein.

    • Synonyms

      Hexokinase-1, EC 2.7.1.1, Hexokinase type I, HK I, Brain form hexokinase, HK1-ta, HK1-tb, HXK1, HK1.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Immunogen

      Anti-human Hexokinase-1 mAb is derived from hybridization of mouse SP2/0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human Hexokinase-1 amino acids 1-917 purified from E. coli.

    • Ig Subclass

      Mouse IgG2a heavy chain and κ light chain.

    • Clone

      P4D7AT.

    • Applications

      Hexokinase-1 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:1,000 ~ 2,000. Recommended starting dilution is 1:1,000.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      Hexokinase-1 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hk1 Antibody
  • View Data Sheet

    Name :

    HIV-1 gp120 Antibody

    Description:

    HIV-1 gp120, Rabbit Antibody

    HIV-1 gp120, HIV1gp120, HIV-I gp120, HIVIgp120.

    Product # :

    ANT-236

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    Purified Rabbit polyclonal antibody to HIV-1 gp120.

    Formulation

    Lyophilized in PBS.

    Purity

    >95% as estimated by SDS-PAGE.

    More Info

    • Introduction

      Human immunodeficiency virus (HIV) is a retrovirus that can lead to a condition in which the immune system begins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the human immune system such as helper T cells (specifically CD4+ T cells), macrophages and dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosis in infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytes that recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunity is lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genome is converted to double-stranded DNA by a virally encoded reverse transcriptase that is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integrase so that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latent and the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.

    • Synonyms

      HIV-1 gp120, HIV1gp120, HIV-I gp120, HIVIgp120.

    • Physical Appearance

      Sterile Filtered White lyophilized (freeze-dried) powder.

    • Stability

      Store at -200C. Avoid freeze/thaw cycles.

    • Solubility

      The lyophilized antibody should be reconstituted in sterile dH2O. The amount of sterilized dH2O can vary depending on the final concentration desired.

    • Immunogen

      Recombinant HIV-1 gp120 produced in baculovirus expression system.

    • Applications

      Binds to recombinant HIV-1 gp120 in ELISA and Western Blot.
      Optimal dilutions should be determined by the customer, based on titration. Suggested starting dilutions if the protein concentration is
      1mg/mL are listed below:
      • Western Blot – 1:500 to 1:1000
      • ELISA – 1:500 to 1:1000.

    • Type

      Polyclonal Rabbit Antibody.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hiv 1Gp120 Polyclonal Purified Antibody
  • View Data Sheet

    Name :

    HSV-1 gD (84-175)

    Description:

    Herpes Simplex Virus-1 gD (84-175 a.a.) Recombinant

    Product # :

    HSV-231

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The E.Coli derived recombinant protein contains the HSV-1 gD (84-175) immunodominant region.

    Source

    Escherichia Coli.

    Formulation

    0.1 % SDS, 50% glycerol and 100 mM NaCl.

    Purity

    Protein is >95% pure as determined by SDS-PAGE

    More Info

    • Introduction

      Receptors across the cell membrane interact with some viral glycoproteins therefor enabling HSV to enter the host cell. The HSV enter through pores created by the binding of particular receptors across the cell membrane with the virus's coating envelope, following by a fusion of the HSV and the host cell. HSV enters the host cell through the same mechanism and stages as other viruses do. Initially, matching receptors across the virus's envelope and host cell's membrane interacts and bring the two together. During the transitional stage, begins fusion between the host cell and virus (hemifusion state). The closing stage happens when a steady pore was made; through these pores the virus's particles enter the cell.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      HSV-1 gD although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hsv1 Gd
  • View Data Sheet

    Name :

    T.gondii p24

    Description:

    Toxoplasma Gondii p24 (GRA1) Recombinant

    Product # :

    TOX-262

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The E.Coli derived recombinant protein contains the p24 (GRA1) immunodominant regions, fused to six histidines at C-terminal.

    Source

    Escherichia Coli.

    Formulation

    (1mg/ml) 1XPBS, pH 7.2 and 50% glycerol.

    Purity

    Toxoplasma protein is >90% pure as determined by SDS-PAGE.

    More Info

    • Introduction

      The life cycle of Toxoplasma gondii has two phases. The coccidia like takes place only in members of the Felidae family which makes these animals the parasite's primary host. The asexual part of the life cycle can take place in any warm-blooded animal, like other mammals(including felines) and birds. T. gondii constructing daughter scaffolds within the mother cell. In the intermediate hosts (including felines), the parasite invades cells, forming intracellular so-called parasitophorous vacuoles containing bradyzoites, the slowly replicating form of the parasit. Vacuoles form tissue cysts mainly within the muscles and brain. Since they are within cells, the host's immune system does not detect these cysts. Resistance to antibiotics varies, but the cysts are very difficult to eradicate entirely. Within these vacuoles T. gondii propagates by a series of binary fissions until the infected cell eventually bursts and tachyzoites are released. Tachyzoites are the motile, asexually reproducing form of the parasite. Unlike the bradyzoites, the free tachyzoites are usually efficiently cleared by the host's immune response, although some manage to infect cells and form bradyzoites, thus maintaining the infection.

    • Stability

      Toxoplasma Protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Purification Method

      Purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Tgondii P24
  • View Data Sheet

    Name :

    MFAP4 Antibody

    Description:

    Microfibrillar-associated Protein 4, Mouse Anti Human

    Microfibrillar-Associated Protein 4, Microfibril-Associated Glycoprotein 4.

    Product # :

    ANT-489

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.

    More Info

    • Introduction

      Microfibrillar-associated protein 4 (MFAP4) is a member of Fibrinogen protein family and contains 1 fibrinogen C-terminal domain. The MFAP4 protein has similarity to a bovine microfibril-associated protein. MFAP4 has binding specificities for both collagen and carbohydrate. MFAP4 is believed to be an extracellular matrix protein that is involved in cell adhesion or intercellular interactions. MFAP4 deletion was found in 30 of 31 Smith-Magenis syndrome (SMS) patients.

    • Synonyms

      Microfibrillar-Associated Protein 4, Microfibril-Associated Glycoprotein 4.

    • Physical Appearance

      Sterile filtered colorless solution.

    • Immunogen

      Anti-human MFAP4 mAb, clone PAT12D11AT, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human MFAP4 protein 22-255 amino acids purified from E. coli.

    • Ig Subclass

      Mouse IgG1 heavy chain and Kappa light chain.

    • Clone

      PAT12D11AT.

    • Applications

      The antibody has been tested by ELISA, Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended starting dilution is 1:1000.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      MFAP4 antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Mfap4 Antibody
  • View Data Sheet

    Name :

    CD57 FITC Antibody

    Description:

    CD57 FITC, Mouse Anti-Human

    NK1, CD57, HNK1, LEU7, NK-1, GLCATP, GLCUATP, B3GAT1.

    Product # :

    ANT-289

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml in PBS (after reconstitution).

    More Info

    • Introduction

      CD57 also called B3GAT1is part of the glucuronyltransferase gene family. CD57 exhibits strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. CD57 takes part in the glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1.

    • Synonyms

      NK1, CD57, HNK1, LEU7, NK-1, GLCATP, GLCUATP, B3GAT1.

    • Solubility

      Reconstitute with of H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.

    • Immunogen

      Human CD57 Positive Cells.

    • Ig Subclass

      Mouse IgM.

    • Clone

      hCD57.

    • Applications

      Staining antibody. For staining, use 10µl/1,000,000 cells.

    • Available Conjugates

      This antibody is also available unconjugated and conjugated to FITC. For staining with biotin or FITC-conjugated antibody use 5-10µl/1,000,000 cells.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      Lyophilized: store at 4°C. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.

    • Purification Method

      Ion-Exchange Column.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Cd57 Fitc Antibody
  • View Data Sheet

    Name :

    CNDP2 Antibody

    Description:

    CNDP Dipeptidase 2, Mouse Anti Human

    Cytosolic non-specific dipeptidase, CNDP dipeptidase 2, CN2, CPGL, HsT2298, PEPA, Glutamate carboxypeptidase-like protein 1, Peptidase A.

    Product # :

    ANT-096

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4 with 0.1% Sodium Azide.

    More Info

    • Introduction

      CNDP Dipeptidase 2 (CNDP2), is a cytosolic, non-specific dipeptidase which is a part of the peptidase M20A protein family. CNDP2 is a secreted peptidase homologous to M20 peptidases. CNDP2 expresses through all adult and fetal tissue, though, an isoform missing exons 3 and 4 expresses in all fetal tissue in adult liver. Over expression of CPGL-B in hepatocellular carcinoma cells results in significant inhibition of HC cell viability, colony formation, cell invasiveness and tumor configuration.

    • Synonyms

      Cytosolic non-specific dipeptidase, CNDP dipeptidase 2, CN2, CPGL, HsT2298, PEPA, Glutamate carboxypeptidase-like protein 1, Peptidase A.

    • Physical Appearance

      Sterile Filtered colorless solution.

    • Immunogen

      Anti-human CNDP2 mAb is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human CMBL 1-475 amino acids purified from E. coli.

    • Ig Subclass

      Mouse IgG1 heavy chain and k light chain.

    • Clone

      PAT15E5AT.

    • Applications

      CNDP2 antibody has been tested by y ELISA, Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:500 ~ 1:5000. Recommended starting dilution is 1:1000.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      CNDP2 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Cndp2 Antibody
  • View Data Sheet

    Name :

    GST, His

    Description:

    Glutathione S-Transferase Recombinant, His Tag

    Glutathione S-Transferase, GST, Glutathione S-transferase class-mu 28 kDa isozyme, GST 28, EC 2.5.1.18, Sj28GST, Sj28 antigen.

    Product # :

    ENZ-451

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • biological activity
    • More Info

    Description

    Recombinant Schistosoma japonicum GST full length protein contains a total of 244 amino acids (1-218 a.a.) expressed in E.coli, having a molecular mass of 28.3kDa. The GST protein is fused to a 20 amino acids His-Tag at N-terminus. The GST protein is purified by proprietary chromatographic techniques.

    Source

    Escherichia Coli.

    Formulation

    GST is supplied in PBS pH 7.4 & 10% glycerol.

    Purity

    Greater than 90% as determined by SDS-PAGE.

    Biological Activity

    >10 units/mg, & is defined as the amount of enzyme that conjugate 1.0 u mole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH-6.5 at 25C.

    More Info

    • Introduction

      Antioxidant enzyme Glutathione S- Transferase (GST) is thought to do the primary cellular defense mechanism against reactive oxygen species. GST reduces lipid hydroperoxides through its Se-independent glutathione peroxidase activity. The enzyme also detoxifies lipid peroxidation end products such as 4-hydroxynonenal (4-HNE).
      The soluble GST is a 26 kDa protein which occurs as a dimer in all aerobic organisms. Each monomer has two domains, one that binds GSH and is an /-structure similar to thioredoxin and the other, all helical, that binds the hydrophobic substrate. The GST -fusion protein expression system is a widely used recombinant protein expression system that allows a peptide or a regulatory protein domain to be expressed as a fusion to the C-terminus of Schistosoma japonicum GST. Fusion proteins also possess GST -enzymatic activity and can undergo dimerization similar to in vivo. The fusion protein can be purified via GST -affinity column chromatography. In most cases, the desired peptides or domains are removed from GST by applying a specific protease that recognizes and cleaves the linker between the protein domain and GST. The technique has been widely used to generate different kinds of proteins for crystallization, molecular immunology studies, the production of vaccines and studies involving protein-protein and protein-DNA interactions.

    • Synonyms

      Glutathione S-Transferase, GST, Glutathione S-transferase class-mu 28 kDa isozyme, GST 28, EC 2.5.1.18, Sj28GST, Sj28 antigen.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

    • Amino Acid Sequence

      MGSSHHHHHH SSGLVPRGSH MSPILGYWKI KGLVQPTRLL LEYLEEKYEE HLYERDEGDK WRNKKFELGL EFPNLPYYID GDVKLTQSMAIIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALDVVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIA WPLQGWQATF GGGDHPPKSD LVPR.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Glutathione S Transferase His
  • View Data Sheet

    Name :

    TBCA Antibody

    Description:

    Tubulin Folding Cofactor A, Mouse Anti Human

    Tubulin-specific chaperone A, Tubulin-folding cofactor A, CFA, TCP1-chaperonin cofactor A, TBCA.

    Product # :

    ANT-362

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.

    More Info

    • Introduction

      TBCA is a tubulin-folding protein which is involved in the early step of the tubulin folding pathway. TBCA is one of four proteins (cofactors A, D, E, and C) implicated in the pathway directing to properly folded beta-tubulin from folding intermediates. Cofactors A and D are thought to be a factor in capturing and stabilizing beta-tubulin in a quasi-native confirmation. TBCA is crucial for cell viability, if reduced it causes a decrease in the amount of soluble tubulin, alterations in microtubules and G1 cell cycle arrest. Cofactor E attaches to the cofactor D-tubulin complex, afterward, interaction with cofactor C triggers the release of tubulin polypeptides that are committed to the native state.

    • Synonyms

      Tubulin-specific chaperone A, Tubulin-folding cofactor A, CFA, TCP1-chaperonin cofactor A, TBCA.

    • Immunogen

      Anti-human TBCA mAb is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human TBCA amino acids 1-108 purified from E. coli.

    • Ig Subclass

      Mouse IgG2b heavy chain and κ light chain.

    • Clone

      PAT1A5AT.

    • Applications

      TBCA antibody has been tested by ELISA, Western blot, ICC/IF and FACS analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      TBCA antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Tbca Antibody
  • View Data Sheet

    Name :

    IL18 Antibody

    Description:

    Interleukin-18, Mouse Anti Human

    Interferon-gamma-inducing factor, IGIF, IL-1g, IL-18, IL1F4, MGC12320, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma, Iboctadekin.

    Product # :

    ANT-212

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml in PBS (after reconstitution).

    More Info

    • Introduction

      IL-18 is a proinflammatory cytokine. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.

    • Synonyms

      Interferon-gamma-inducing factor, IGIF, IL-1g, IL-18, IL1F4, MGC12320, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma, Iboctadekin.

    • Solubility

      Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.

    • Immunogen

      r.Human IL-18.

    • Ig Subclass

      Mouse IgG1.

    • Clone

      YNR-HIL18.

    • Applications

      Direct ELISA, Western Blot, Immuneprecipitation.

    • Titer

      By direct ELISA, 1:10,000 dilution will yield 0.8 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).

    • Shipping Conditions

      Antibody is shipped lyophilized at ambient temperature.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      In lyophilized form, for long periods, store at 4C in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20C.

    • Purification Method

      Ion exchange.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Il 18 Antibody
  • View Data Sheet

    Name :

    CASQ2 Antibody

    Description:

    Calsequestrin-2, Mouse Anti Human

    PDIB2, CASQ2, Calsequestrin-2, Calsequestrin cardiac muscle isoform, FLJ26321, FLJ93514.

    Product # :

    ANT-045

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, & 0.02% Sodium Azide and 10% Glycerol.

    More Info

    • Introduction

      CASQ2 belongs to the calsequestrin family and is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. CASQ2 is a calcium binding protein that stores calcium for muscle function. The discharge of calcium bound to CASQ2 through a calcium release channel activates muscle contraction. CASQ2 binds 40 to 50 moles of calcium. CASQ2 mutations result in stress-induced polymorphic ventricular tachycardia, also called catecholaminergic polymorphic ventricular tachycardia 2 which is known fir its bidirectional ventricular tachycardia that causes cardiac arrest.

    • Synonyms

      PDIB2, CASQ2, Calsequestrin-2, Calsequestrin cardiac muscle isoform, FLJ26321, FLJ93514.

    • Immunogen

      Anti-human CASQ2 mAb, is derived from hybridization of mouse FO myeloma cells with spleen cells from BALB/c mice immunized with recombinant human CASQ2 amino acids 20-399 purified from E. coli.

    • Ig Subclass

      Mouse IgG1 heavy chain and k light chain.

    • Clone

      PAT4E10AT.

    • Applications

      CASQ2 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:1000.
      Recommended starting dilution is 1:1000.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      CASQ2 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Casq2 Antibody
  • View Data Sheet

    Name :

    HA-HRP Antibody

    Description:

    HA Mouse Antibody, Peroxidase Conjugated

    Product # :

    ANT-226

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • More Info

    Description

    Monoclonal antibodies are produced by immunizing mouse with synthetic peptide (YPYDVPDYA) coupled to KLH.

    Formulation

    1×PBS & 50% glycerol.

    More Info

    • Ig Subclass

      Mouse IgG1.

    • Clone

      PHAHRPSHG.

    • Applications

      Western Blot.

    • Titer

      Western Blotting: 1:1000.

    • Type

      Mouse Antibody Monoclonal.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Ha Hrp Antibody
  • View Data Sheet

    Name :

    CIAO1 Antibody

    Description:

    Cytosolic Iron-Sulfur Protein Assembly 1, Mouse Anti Human

    CIA1, WDR39, Probable cytosolic iron-sulfur protein assembly protein CIAO1, WD repeat-containing protein 39, CIAO1.

    Product # :

    ANT-482

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.

    More Info

    • Introduction

      CIAO1 is a vital component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. CIAO1 protein is required for the maturation of extra mitochondrial Fe/S proteins and seems to specifically modulate the trans-activation activity of WT1. CIAO1 participates in chromosome segregation as a part of the mitotic spindle-associated MMXD complex.

    • Synonyms

      CIA1, WDR39, Probable cytosolic iron-sulfur protein assembly protein CIAO1, WD repeat-containing protein 39, CIAO1.

    • Physical Appearance

      Sterile filtered colorless solution.

    • Immunogen

      Anti-human CIAO1 mAb, clone PAT6C9A, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human CIAO1 protein 1-339 amino acids purified from E. coli.

    • Ig Subclass

      Mouse IgG1 heavy chain and Kappa light chain.

    • Clone

      PAT6C9A.

    • Applications

      The antibody has been tested by ELISA, Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:500 ~ 1:5000. Recommended starting dilution is 1:1000.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      CIAO1 antibody was purified by protein-A affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Ciao1 Antibody
  • View Data Sheet

    Name :

    BMP-7 Antibody

    Description:

    Bone Morphogenetic Protein-7 Polyclonal Rabbit Anti Human Antibody

    Osteogenic Protein 1, BMP-7.

    Product # :

    ANT-037

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • purity
    • More Info

    Formulation

    Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.

    Purity

    Greater than 98%.

    More Info

    • Introduction

      The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.

    • Synonyms

      Osteogenic Protein 1, BMP-7.

    • Stability

      Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.

    • Solubility

      Add 100 ?l of distilled water to create a final concentration of 1 mg/ml.

    • Immunogen

      IgG Anti BMP-7 has been developed in rabbit using highly pure (>98%) recombinant human BMP-7 expressed in plants.

    • Applications

      Western Blot: to detect human BMP-7 by WB analysis this IgG can be used in a dilution of 1:500. For optimal usage we suggest overnight incubation.

    • Antigen Amino Acid Sequence

      FPTI PLSRLFDNAM LRAHRLHQLA FDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLE LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF.

    • Type

      Polyclonal Rabbit Antibody.

    • Purification Method

      Purified IgG prepared by affinity chromatography on protein G.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Bmp 7 Antibody
  • View Data Sheet

    Name :

    HSP90 Alpha Antibody

    Description:

    Heat shock protein HSP 90-alpha, Mouse Anti Human

    HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, HSP90A, HSP90N, HSPCAL1, HSPCAL4, FLJ31884, Heat shock protein HSP 90-alpha, Renal carcinoma antigen NY-REN-38, HSP 86, HSP90AA1.

    Product # :

    ANT-398

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • formulation
    • More Info

    Formulation

    1mg/ml containing PBS, pH-7.4, 0.02% Sodium Azide and 10% Glycerol.

    More Info

    • Introduction

      HSP90 has been identified in the cytosol, nucleus and endoplasmic reticulum, and is reported to exist in many tissue types. In several tissues, including smooth muscle, HSP90 comprises up to 2% of total cellular protein. HSP90 functions as a dimer, assembled as part of heterocomplex. It possesses ATP-binding site and low ATPase activity. HSP90 is able to associate with actin filaments in certain conditions. Another important property of HSP90 is the binding of unoccupied steroid hormone receptors. HSP90 has been characterized as a molecular chaperone able to keep the target protein in a folding-competent state. It has an enhanced chaperone activity in oligomeric form at high temperatures. HSP90 function is sensitive to bivalent cations concentration.

    • Synonyms

      HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, HSP90A, HSP90N, HSPCAL1, HSPCAL4, FLJ31884, Heat shock protein HSP 90-alpha, Renal carcinoma antigen NY-REN-38, HSP 86, HSP90AA1.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Immunogen

      Anti-human HSP90A mAb, is derived from hybridization of mouse SP2/0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human HSP90A amino acids 1-732 purified from E. coli.

    • Ig Subclass

      Mouse IgG2b heavy chain and κ light chain.

    • Clone

      P4F10AT.

    • Applications

      HSP90A antibody has been tested by ELISA, Western blot and immunohistochemistry analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot is 1:500 ~ 1:2,000 and immunohistochemistry analysis is 1:100~200. Recommended starting dilution for Western blot is 1:1,000 and Immunohistochemistry is 1:100.

    • Type

      Mouse Anti Human Monoclonal.

    • Storage Procedures

      For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.

    • Purification Method

      HSP90A antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hsp90 Alpha Antibody
  • 1
  • …
  • 26
  • 27
  • 28
  • 29
  • 30
  • …
  • 42
Your browser does not support the video tag.

Products

  • Cytokines
  • Growth Factors
  • Chemokines
  • CD Antigens
  • Neurotrophins
  • Hormones
  • Enzymes
  • Viral Antigens
  • Recombinant Proteins
  • Natural Proteins
  • Monoclonal Antibodies
  • Polyclonal Antibodies
  • Thermal Packaging

About

  • Company
  • Founder
  • Contribution
  • Contact Us
  • My Account

Ordering

  • Ordering Method
  • Ordering - Credit Card
  • Ordering PO
  • Shipping Fees
  • FAQ's

Legal

  • Terms & Conditions
  • Privacy
  • Site Map
  • info@prospecbio.com
  • Facebook
  • Instagram
  • Linkedin Profile

© 2026 ProSpec-Tany TechnoGene Ltd. All Rights Reserved.

  • Choosing a selection results in a full page refresh.
  • Opens in a new window.