Search results

What is the molecular weight/Mw of CXCL16 MOUSE Protein?
CXCL16 MOUSE Protein has a total Mw of 9.9kDa.

What is the source or expression system of CXCL16 MOUSE Protein?
Escherichia Coli.

What is the Purity of CXCL16 MOUSE Protein?
CXCL16 MOUSE Protein is >97% pure as determined by SDS-PAGE.

What is the Biological Activity of CXCL16 MOUSE Protein?
Determined by its ability to chemoattract murine lymphocytes using a concentration range of 100-1000ng/ml corresponding to a Specific Activity of 1,000-10,000IU/mg.

What is the amino acid sequence of CXCL16 MOUSE Protein?
NQGSVAGSCS CDRTISSGTQ IPQGTLDHIR KYLKAFHRCP FFIRFQLQSK SVCGGSQDQW VRELVDCFER KECGTGHGKS FHHQKHLP.

What applications can CXCL16 MOUSE Protein be used in?
CXCL16 MOUSE Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for CXCL16 MOUSE Protein?
The endotoxin level is minimal, CXCL16 MOUSE Protein was purified using conventional chromatography techniques.

Adiponectin Human Recombinant: Unraveling its Potential in Therapeutic Applications

1. Abstract

This paper aims to deliver an extensive exploration into Adiponectin Human Recombinant, a vital adipokine implicated in a multitude of metabolic processes. By delving into the structure, biological roles, and signaling pathways of adiponectin, we elucidate its contribution to pathophysiological conditions. Moreover, we examine the potential therapeutic application of adiponectin in metabolic and cardiovascular diseases.

2. Introduction

Adiponectin, a protein predominantly secreted by adipose tissue, plays an integral part in regulating metabolic processes such as glucose regulation and fatty acid oxidation. Understanding the intricacies of adiponectin's actions could pave the way for innovative therapeutic interventions in diseases like obesity, diabetes, and cardiovascular disease.

3. Structure and Signaling of Adiponectin

Adiponectin is a 30kDa protein consisting of a collagen-like domain and a C-terminal globular domain. It signals through adiponectin receptors AdipoR1 and AdipoR2, which then activate several intracellular signaling pathways, including AMP-activated protein kinase (AMPK) and peroxisome proliferator-activated receptor-alpha (PPAR-α), regulating various metabolic processes.

4. Biological Functions of Adiponectin

Adiponectin has been shown to enhance insulin sensitivity, stimulate fatty acid oxidation, and exert anti-inflammatory effects. Additionally, it is involved in regulating energy homeostasis and has been linked to the regulation of food intake and body weight.

5. Adiponectin in Disease Pathology

Reduced levels of adiponectin have been associated with obesity, insulin resistance, type 2 diabetes, and cardiovascular disease. Moreover, adiponectin deficiency has been observed in metabolic syndrome, emphasizing the adipokine's crucial role in metabolic health.

6. Therapeutic Potential of Adiponectin

Given adiponectin's role in metabolic regulation, its potential as a therapeutic target is of considerable interest. Approaches to increase circulating adiponectin levels or enhance adiponectin signaling could offer potential therapeutic strategies for managing metabolic diseases and cardiovascular conditions.

7. Conclusion and Future Perspectives

While our understanding of adiponectin and its role in health and disease has greatly advanced in recent years, there is still much to uncover. Further research on the precise molecular mechanisms of adiponectin could pave the way for novel therapeutic approaches.

What is the molecular weight / Mw of ADIPONECTIN Protein?
ADIPONECTIN Protein has a total Mw of 25.1kDa.
What is the source or expression system of ADIPONECTIN Protein?
Escherichia Coli.

What is the Purity of ADIPONECTIN Protein?
ADIPONECTIN Protein is >90% pure as determined by SDS-PAGE.

What is the Biological Activity of ADIPONECTIN Protein?
The biological functionality of ADIPONECTIN Protein will be determined in the future.

What is the amino acid sequence of ADIPONECTIN Protein?
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE
KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV
GLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKD
VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE
RNGLYADNDNDSTFTGFLLYHDTN..

What applications can ADIPONECTIN Protein be used in?
ADIPONECTIN Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for ADIPONECTIN Protein?
The endotoxin level is minimal, ADIPONECTIN Protein was purified using conventional chromatography techniques

Apolipoprotein C-I Human Recombinant: Unraveling the Complexity of Lipid Regulation

Abstract:

Apolipoprotein C-I (ApoC-I) is a remarkable protein that plays a significant role in lipid metabolism and cardiovascular health. It is primarily synthesized in the liver and is associated with lipoproteins involved in lipid transport. This research paper aims to provide a comprehensive overview of ApoC-I human recombinant, shedding light on its physiological functions, production methods, and potential therapeutic applications. By delving into the intricacies of ApoC-I, we can gain valuable insights into its role as a key player in lipid regulation and its potential as a therapeutic target.

Introduction:

The prevalence of lipid disorders and cardiovascular diseases necessitates a deeper understanding of the mechanisms governing lipid metabolism. ApoC-I, a critical component of lipoproteins, offers unique insights into the regulation of lipid levels and its implications for cardiovascular health.

Structure and Function of Apolipoprotein C-I:

ApoC-I exhibits a complex molecular structure, comprising functional domains that enable its interaction with lipoproteins. It plays a crucial role in regulating lipoprotein metabolism by inhibiting the activity of lipoprotein lipase and modulating the clearance of triglyceride-rich lipoproteins.

Regulation of Apolipoprotein C-I Expression:

The synthesis and secretion of ApoC-I are tightly regulated processes influenced by various factors, including nutritional status and hormonal signals. Understanding the regulatory mechanisms underlying ApoC-I expression can provide insights into its role in maintaining lipid homeostasis.

Apolipoprotein C-I and Cardiovascular Diseases:

Dysregulation of ApoC-I has been associated with various lipid disorders and cardiovascular diseases. Altered levels of ApoC-I have been observed in conditions such as hypertriglyceridemia and atherosclerosis, highlighting its potential as a biomarker for cardiovascular risk assessment.

Production of Apolipoprotein C-I Human Recombinant:

Recombinant ApoC-I can be produced using advanced biotechnological approaches, including recombinant DNA technology and protein expression systems. These methods enable large-scale production, purification, and characterization of ApoC-I, facilitating its potential therapeutic applications.

Therapeutic Potential of Apolipoprotein C-I Human Recombinant:

Targeting ApoC-I opens up exciting avenues for therapeutic interventions in lipid disorders and cardiovascular diseases. Modulating ApoC-I expression or function holds promise for restoring lipid balance and reducing the risk of cardiovascular complications.

Conclusion:

Apolipoprotein C-I human recombinant represents a fascinating area of research in the field of lipid metabolism and cardiovascular health. By unraveling the intricate interplay between ApoC-I, lipoproteins, and cardiovascular diseases, we can pave the way for novel therapeutic strategies and improved risk assessment. Further studies are required to fully understand the therapeutic potential of ApoC-I human recombinant and translate these findings into clinical applications.

What is the molecular weight/Mw of APOC1 Protein?
APOC1 Protein has a total Mw of 9kDa.

What is the source or expression system of APOC1 Protein?
Escherichia Coli.

What is the Purity of APOC1 Protein?
APOC1 Protein is >85% pure as determined by SDS-PAGE.

What is the Biological Activity of APOC1 Protein?
The biological functionality of APOC1 Protein will be determined in the future.

What is the amino acid sequence of APOC1 Protein?
MGSSHHHHHH SSGLVPRGSH MGSTPDVSSA LDKLKEFGNT LEDKARELIS RIKQSELSAK MREWFSETFQ KVKEKLKIDS.

What applications can APOC1 Protein be used in?
APOC1 Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for APOC1 Protein?
The endotoxin level is minimal, APOC1 Protein was purified using conventional chromatography techniques.

What is the molecular weight/Mw of APO D Protein?
APO D Protein has a total Mw of 48kDa.

What is the source or expression system of APO D Protein?
Escherichia Coli.

What is the Biological Activity of APO D Protein?
The biological functionality of APO D Protein will be determined in the future.

What applications can APO D Protein be used in?
APO D Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for APO D Protein?
The endotoxin level is minimal, APO D Protein was purified using conventional chromatography techniques.

Myelin Basic Protein (MBP) stands as a cornerstone in the intricate architecture of the nervous system. As a vital component of the myelin sheath, MBP plays a pivotal role in ensuring the integrity and rapid transmission of nerve impulses. Over the years, scientific inquiry into MBP has revealed its multifaceted functions, not only as a structural element but also as a regulatory molecule involved in various cellular processes. This research seeks to unravel the complexities of MBP, exploring its structural characteristics, physiological significance, and its involvement in neurological disorders.

Structural Marvel of MBP:

MBP, an intrinsically disordered protein, boasts a unique structure allowing it to interact with lipid membranes, especially those found in the myelin sheath. Its high arginine and lysine content gives it a positive charge, enabling strong electrostatic interactions with the negatively charged lipids in myelin. This structural adaptation is crucial for the compact wrapping of myelin around axons, facilitating efficient electrical signal conduction.

Physiological Significance in Myelination:

In the central nervous system (CNS), oligodendrocytes produce myelin, a lipid-rich substance that insulates axons. MBP, as a major constituent of myelin, plays an indispensable role in this process. It stabilizes the myelin sheath’s structure, ensuring its tight adherence to the axon and promoting the fast, saltatory conduction of nerve impulses. Without functional MBP, myelin integrity is compromised, leading to reduced nerve conduction velocity and impaired neural communication.

Beyond Structural Functions:

Recent studies have revealed that MBP is not merely a structural protein but also possesses regulatory functions. It participates in signaling pathways crucial for oligodendrocyte development and myelination. Moreover, MBP’s interaction with cytoskeletal elements suggests its involvement in cellular processes such as axon guidance and neuronal plasticity. Understanding these regulatory roles provides insights into the broader impact of MBP on neural development and function.

Implications in Neurological Disorders:

Alterations in MBP have been linked to various neurological disorders, including multiple sclerosis (MS). In MS, the immune system erroneously targets MBP, leading to demyelination and subsequent neurological impairments. Research into MBP-related pathologies not only aids in understanding disease mechanisms but also offers potential therapeutic avenues. Targeting MBP-specific immune responses is a focus of research for developing MS treatments.

Conclusion:

MBP, as the guardian of neural transmission, stands as a testament to the marvels of biological architecture. Its intricate structure and multifaceted functions make it indispensable for the proper functioning of the nervous system. Beyond its role as a structural protein, MBP’s involvement in cellular signalling adds layers to its significance. In the realm of neurological disorders, MBP’s complexities provide both challenges and opportunities, guiding scientists toward innovative therapies. This research delves into the world of MBP, appreciating its contributions to neuroscience while aiming to decipher the mysteries that lie within its molecular intricacies.

What You Should Know About Bone Morphogenetic Protein-4 (BMP-4) Human Recombinant

As part of the transforming growth factor-beta (TGF-β) superfamily, Bone morphogenetic protein-4 (BMP-4) participates in multiple developmental processes, from embryogenesis to bone and cartilage formation.

Since this signaling protein is involved in many physiological processes, its laboratory-produced version has been studied for different medical applications. Additionally, a reduction in BMP-4 expression has been associated with multiple diseases, leading to further research into its potential therapeutic benefits.

Are you interested in learning more about Bone Morphogenetic Protein-4 (BMP-4) human recombinant? Read on to find more information!

How Does Bone Morphogenetic Protein-4 (BMP-4) Work?

Bone Morphogenetic Protein-4 (BMP-4) regulates microRNAs miR-494 and miR-126-5p expression, controlling endothelial cells' involvement and function in angiogenesis. As such, it has diverse effects on cell growth, differentiation, and survival.

The Role of BMP-4

This protein emits signals that promote the formation of different tissues and organs, including the bones and cartilage, kidneys, teeth, and the neural tube. In other words, it's essential for the development of the heart, skeleton, and central nervous system.

However, the role of BMP-4 goes beyond these processes. It participates in different physiological activities, such as:

• Embryonic development
• Wound healing
• Bone remodeling
• Immune response modulation
• Tissue repair
• Cardiac development and function

What Is Bone Morphogenetic Protein-4 (BMP-4) Human Recombinant?

To replicate the effects of the BMP4 found in humans and explore its possible therapeutic applications, many laboratories have started producing this protein in Chinese hamster ovary (CHO) cells.

As mentioned, decreased BMP-4 expression has been associated with different diseases, including bone disorders, fibrosis, and cancer, which can cause other conditions, such as organ dysfunction.

More research is needed, but BMP-4 human recombinant (rhBMP4) produced in CHO has the potential to address these diseases and could be used for other medical applications. These are some examples:

• Cancer therapy
• Development of engineered tissues and organs
• Bone regeneration for the treatment of osteoporosis and nonunion fractures
• Bone growth and fusion in spinal fusion surgeries (the U.S. Food and Drug Administration approved some bone morphogenetic proteins for these procedures)
• Promotion of tissue repair and regeneration

Final Thoughts BMP-4

Although BMP-4 human recombinant produced in CHO offers potential benefits, several challenges remain, including possible side effects, as high doses can cause inflammation, bone overgrowth, and other issues.

However, the long-term effects of rhBMP4 are still under investigation. Further research will provide solutions to address these challenges and allow experts to explore this laboratory-produced protein's power in different medical fields.

What is the molecular weight/Mw of BMP4 Protein?
BMP4 Protein has a total Mw of 13kDa.

What is the source or expression system of BMP4 Protein?
Escherichia Coli.

What is the Purity of BMP4 Protein?
BMP4 Protein is >95% pure as determined by SDS-PAGE.

What is the Biological Activity of BMP4 Protein?
The biological functionality of BMP4 Protein will be determined in the future.

What is the amino acid sequence of BMP4 Protein?
SPKHHSQRAR KKNKNCRRHS LYVDFSDVGW NDWIVAPPGY QAFYCHGDCP FPLADHLNST NHAIVQTLVN SVNSSIPKAC CVPTELSAIS MLYLDEYDKV VLKNYQEMVV EGCGCR.

What applications can BMP4 Protein be used in?
BMP4 Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for BMP4 Protein?
The endotoxin level is minimal, BMP4 Protein was purified using conventional chromatography techniques.

D-dimer, a small protein fragment present in the blood after a blood clot dissolves, is a vital marker in the realms of hematology and vascular medicine. Its presence signifies the ongoing process of fibrinolysis, where clots formed in blood vessels are broken down. Beyond its diagnostic significance, understanding the roles of D-dimer in human physiology and pathology is essential for comprehending coagulation disorders and cardiovascular diseases. This research delves into the multifaceted aspects of D-dimer, exploring its physiological functions, diagnostic applications, and implications in various medical conditions.

Physiological Functions:

In physiological conditions, coagulation and fibrinolysis are finely regulated processes, ensuring hemostasis and preventing excessive bleeding or clot formation. D-dimer is a natural byproduct of fibrinolysis, created when plasmin, an enzyme, breaks down fibrin clots. In this context, D-dimer acts as a marker of the body's intricate balance between clot formation and dissolution. It reflects the ongoing maintenance of vascular integrity, showcasing the body's ability to prevent unnecessary clotting.

Diagnostic Significance:

D-dimer holds significant diagnostic value, especially in the context of thrombotic disorders. Elevated levels of D-dimer in the blood are indicative of increased fibrinolysis, potentially signaling an underlying clotting disorder. Clinically, D-dimer assays are widely used to rule out thromboembolic events, such as deep vein thrombosis (DVT) or pulmonary embolism (PE). Moreover, D-dimer levels are crucial in risk stratification and decision-making processes in emergency departments, aiding in the timely diagnosis and treatment of thrombotic conditions.

Cardiovascular Implications:

Research has indicated a strong correlation between elevated D-dimer levels and cardiovascular diseases. In conditions like coronary artery disease (CAD) and stroke, where abnormal clot formation contributes to pathogenesis, D-dimer serves as a prognostic marker. Its presence hints at the ongoing vascular damage and the potential risk of acute events. Studying these correlations provides valuable insights into the progression of cardiovascular diseases, aiding in the development of targeted therapeutic strategies.

Beyond Coagulation Disorders:

Interestingly, recent research has begun to explore D-dimer's involvement in conditions beyond coagulation disorders. Studies suggest links between elevated D-dimer levels and inflammatory diseases, such as sepsis and rheumatoid arthritis. This expanding scope highlights the intricate interplay between coagulation, inflammation, and immune responses, shedding light on novel avenues for therapeutic interventions.

Conclusion:

D-dimer, once a simple marker of fibrinolysis, has evolved into a multifaceted indicator in the realm of medicine. Its physiological role as a byproduct of clot dissolution is intertwined with its diagnostic significance in thrombotic events and cardiovascular diseases. Furthermore, emerging research is uncovering its involvement in inflammatory processes, broadening its clinical implications. By delving into the complexities of D-dimer, scientists and clinicians pave the way for a deeper understanding of coagulation disorders and associated conditions, driving advancements in diagnostics and therapies.

Apolipoprotein-B Human: Unveiling the Key Player in Cholesterol Transport

Abstract:

Apolipoprotein-B (ApoB), a pivotal component of lipoproteins, plays a critical role in cholesterol metabolism and transportation. It is primarily synthesized in the liver and intestines, existing in two main isoforms: ApoB-100 and ApoB-48. This research paper aims to provide a comprehensive overview of ApoB human, emphasizing its physiological functions, regulatory mechanisms, and implications in cardiovascular diseases. By delving into the intricacies of ApoB, we can gain valuable insights into its significance as a therapeutic target and potential biomarker.

Introduction:

The prevalence of cardiovascular diseases necessitates a deeper understanding of the mechanisms governing cholesterol metabolism. ApoB, an integral component of lipoproteins, holds the key to unlocking vital insights into cholesterol transport and its association with atherosclerosis.

Structure and Function of Apolipoprotein-B:

ApoB exhibits a complex molecular structure, consisting of functional domains that enable its interaction with lipids and receptors. ApoB-100, the longer isoform, is primarily associated with low-density lipoprotein (LDL) particles, while ApoB-48 is present in chylomicrons and chylomicron remnants. These isoforms serve distinct roles in lipoprotein metabolism and cholesterol delivery to peripheral tissues.

Regulation of Apolipoprotein-B:

The synthesis and secretion of ApoB are tightly regulated processes influenced by various factors, including dietary and genetic factors. Transcriptional and post-transcriptional mechanisms govern the expression and processing of ApoB, ensuring its proper function in cholesterol transport.

Apolipoprotein-B and Cardiovascular Diseases:

Elevated levels of ApoB-containing lipoproteins, such as LDL, have been implicated in the development of atherosclerosis and cardiovascular diseases. The ratio of ApoB to ApoA-I, known as the ApoB/ApoA-I ratio, serves as a reliable marker for cardiovascular risk assessment, with higher ratios indicating increased risk.

Therapeutic Implications of Apolipoprotein-B:

Targeting ApoB presents a promising avenue for managing dyslipidemia and reducing cardiovascular risk. Strategies aimed at reducing ApoB production or enhancing its clearance have shown efficacy in clinical trials, underscoring the potential of ApoB as a therapeutic target.

Conclusion:

Apolipoprotein-B human serves as a cornerstone in cholesterol transport, playing a crucial role in lipoprotein metabolism and its implications for cardiovascular health. By unraveling the intricate interplay between ApoB, cholesterol metabolism, and atherosclerosis, we can pave the way for novel therapeutic interventions and improved risk assessment in cardiovascular diseases.

What is the molecular weight/Mw of APOB Protein?
APOB Protein has a total Mw of 550kDa.

What is the source or expression system of APOB Protein?
Human Plasma.

What is the Purity of APOB Protein?
APOB Protein is >90% pure as determined by SDS-PAGE.

What is the Biological Activity of APOB Protein?
The biological functionality of APOB Protein will be determined in the future.

What applications can APOB Protein be used in?
APOB Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for APOB Protein?
The endotoxin level is minimal, APOB Protein was purified using conventional chromatography techniques.

Apolipoprotein-M Human Recombinant: Insights into its Role in Lipid Metabolism and Cardiovascular Health

Abstract:

Apolipoprotein-M (ApoM), a unique member of the apolipoprotein family, has gained significant attention in the field of lipid metabolism and cardiovascular health. This research paper provides a comprehensive analysis of ApoM human recombinant, exploring its structure, function, and potential implications in cardiovascular diseases. Understanding the intricate nature of ApoM sheds light on its significance as a potential biomarker and therapeutic target in cardiovascular disorders. This article presents a concise yet comprehensive examination of ApoM, highlighting its impact on human health.

Introduction:

Cardiovascular diseases remain a leading cause of global morbidity and mortality, underscoring the importance of understanding lipid metabolism and its association with cardiovascular health. ApoM, an intriguing apolipoprotein, has emerged as a key player in lipid metabolism and cardiovascular function. This paper delves into the intricate nature of ApoM, elucidating its structure, molecular interactions, and potential roles in cardiovascular diseases.

Structure and Function of Apolipoprotein-M:

ApoM exhibits a unique structural configuration, comprising a single membrane-bound alpha-helix and a lipocalin-like domain. It predominantly associates with high-density lipoproteins (HDL) and plays a critical role in HDL metabolism and cholesterol transport. Additionally, ApoM has been implicated in endothelial function, inflammation, and modulation of sphingolipid metabolism.

Apolipoprotein-M and Cardiovascular Diseases:

Studies have highlighted the potential involvement of ApoM in cardiovascular diseases, such as atherosclerosis and coronary artery disease. Genetic variations in the ApoM gene and alterations in ApoM levels have been associated with disease development and progression. Understanding the role of ApoM in cardiovascular diseases offers insights into potential therapeutic interventions and diagnostic strategies.

Apolipoprotein-M Human Recombinant Production:

The production of ApoM human recombinant is made possible through advanced biotechnological techniques, including recombinant DNA technology and protein expression systems. These methods facilitate large-scale production, purification, and characterization of ApoM, providing opportunities for further research and potential therapeutic applications.

Therapeutic Potential of Apolipoprotein-M Human Recombinant:

Exploring the therapeutic potential of ApoM holds promise in the field of cardiovascular disorders. Strategies aimed at modulating ApoM expression or function may contribute to the prevention or treatment of lipid metabolism-related diseases. Furthermore, ApoM may serve as a potential biomarker for risk assessment and monitoring of cardiovascular conditions.

Conclusion:

Apolipoprotein-M human recombinant represents a fascinating area of research, shedding light on the role of this protein in lipid metabolism and cardiovascular health. Understanding the structure, function, and genetic implications of ApoM is pivotal in advancing our knowledge and exploring its potential as a therapeutic target. Continued investigation into the mechanisms and signaling pathways involving ApoM will likely pave the way for innovative strategies in the diagnosis, prevention, and treatment of cardiovascular diseases.

What is the molecular weight/Mw of APOM Protein?
APOM Protein has a total Mw of 20.9kDa.

What is the source or expression system of APOM Protein?
Escherichia Coli.

What is the Purity of APOM Protein?
APOM Protein is >90% pure as determined by SDS-PAGE.

What is the Biological Activity of APOM Protein?
The biological functionality of APOM Protein will be determined in the future.

What is the amino acid sequence of APOM Protein?
MGSSHHHHHH SSGLVPRGSH MCPEHSQLTT LGVDGKEFPE VHLGQWYFIA GAAPTKEELA TFDPVDNIVF NMAAGSAPMQ LHLRATIRMK DGLCVPRKWI YHLTEGSTDL RTEGRPDMKT ELFSSSCPGG IMLNETGQGY QRFLLYNRSP HPPEKCVEEF KSLTSCLDSK AFLLTPRNQE ACELSNN.

What applications can APOM Protein be used in?
APOM Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for APOM Protein?
The endotoxin level is minimal, APOM Protein was purified using conventional chromatography techniques.

Apolipoprotein-H Human Recombinant: Unleashing the Potential for Cardiovascular Health

Abstract:

Apolipoprotein-H (Apo-H) is a remarkable protein with diverse functions in lipid metabolism and thrombotic regulation. This research paper provides an in-depth analysis of Apo-H human recombinant, exploring its physiological roles, genetic implications, and potential therapeutic applications. Understanding the intricacies of Apo-H sheds light on its significance in cardiovascular health and highlights its potential as a therapeutic target. This article offers a concise yet comprehensive examination of Apo-H, emphasizing its impact on human well-being.

Introduction:

Cardiovascular health is of utmost importance in preventing and managing cardiovascular diseases. Apo-H, a multifunctional protein involved in lipid metabolism and thrombotic regulation, offers a unique perspective in understanding these processes. This paper explores the multifaceted nature of Apo-H, elucidating its genetic implications and its role as a potential guardian of cardiovascular well-being.

Structure and Function of Apolipoprotein-H:

Apo-H possesses a complex molecular structure, consisting of distinct domains that facilitate interactions with lipoproteins and coagulation factors. It plays a critical role in lipid transport, regulating triglyceride-rich lipoproteins. Additionally, Apo-H contributes to the delicate balance of thrombotic processes through its anticoagulant and fibrinolytic activities.

Genetic Implications of Apolipoprotein-H:

The APOH gene, responsible for encoding Apo-H, exhibits genetic variations that can influence an individual's susceptibility to cardiovascular diseases. Understanding these genetic variations helps identify potential risk factors and therapeutic targets for cardiovascular disorders.

Apolipoprotein-H and Cardiovascular Diseases:

Apo-H has garnered significant attention in the field of cardiovascular diseases, particularly in relation to atherosclerosis and thrombotic events. Its versatility allows modulation of inflammatory responses, maintenance of endothelial function, and regulation of coagulation pathways. Investigating the intricate interplay between Apo-H and cardiovascular processes may yield innovative therapeutic strategies.

Production of Apolipoprotein-H Human Recombinant:

Cutting-edge biotechnological techniques, such as recombinant DNA technology and protein expression systems, enable the production of Apo-H human recombinant. These methods facilitate large-scale production, purification, and characterization of Apo-H, providing opportunities for potential therapeutic applications.

Therapeutic Potential of Apolipoprotein-H Human Recombinant:

Leveraging the therapeutic potential of Apo-H holds promise in cardiovascular interventions. Strategies aimed at enhancing Apo-H expression or function may contribute to lipid homeostasis, prevent thrombotic events, and reduce the risk of cardiovascular diseases.

Conclusion:

Apolipoprotein-H human recombinant represents a fascinating area of research, bridging the realms of lipid metabolism and cardiovascular health. Understanding the genetic implications and cardiovascular protective properties of Apo-H is pivotal in advancing our knowledge and developing novel therapeutic approaches for cardiovascular diseases. Continued investigation into the functions and mechanisms of Apo-H will likely unveil innovative strategies for promoting cardiovascular well-being.

What is the molecular weight/Mw of APOH Protein?
APOH Protein has a total Mw of 38.6kDa.

What is the source or expression system of APOH Protein?
Escherichia Coli.

What is the Purity of APOH Protein?
APOH Protein is >85% pure as determined by SDS-PAGE.

What is the Biological Activity of APOH Protein?
The biological functionality of APOH Protein will be determined in the future.

What is the amino acid sequence of APOH Protein?
MGSSHHHHHH SSGLVPRGSH MGSGRTCPKP DDLPFSTVVP LKTFYEPGEE ITYSCKPGYV SRGGMRKFIC PLTGLWPINT LKCTPRVCPF AGILENGAVR YTTFEYPNTI SFSCNTGFYL NGADSAKCTE EGKWSPELPV CAPIICPPPS IPTFATLRVY KPSAGNNSLY RDTAVFECLP QHAMFGNDTI TCTTHGNWTK LPECREVKCP FPSRPDNGFV NYPAKPTLYY KDKATFGCHD GYSLDGPEEI ECTKLGNWSA MPSCKASCKV PVKKATVVYQ GERVKIQEKF KNGMLHGDKV SFFCKNKEKK CSYTEDAQCI DGTIEVPKCF KEHSSLAFWK TDASDVKPC.

What applications can APOH Protein be used in?
APOH Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for APOH Protein?
The endotoxin level is minimal, APOH Protein was purified using conventional chromatography techniques.