TNNI3 Human

TNNI3 Human

Quick Order

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    TNNI3 Human

    Description:

    Cardiac Troponin I Human Recombinant

    Troponin I cardiac muscle, Cardiac troponin I, TNNI3, TNNC1, CMH7, RCM1, cTnI, CMD2A, MGC116817.

    Product # :

    PRO-324

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add :

  • description
  • source
  • formulation
  • purity
  • More Info

Description

Recombinant Human TNNI3 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 210 amino acids having an additional methionine residue at N-terminus
The TNNI3 is purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Formulation

Human TNNI3 was lyophilized in 0.01M HCl.

Purity

Greater than 95.0% as determined by both SDS-PAGE.

More Info

  • Introduction

    Troponin I (TnI), troponin T (TnT) and troponin C (TnC) form the troponin complex of the thin filaments of striated muscle. TnI is acts as the inhibitory subunit by blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains 3 genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. The TNNI3 gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in the TNNI3 gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM).

  • Synonyms

    Troponin I cardiac muscle, Cardiac troponin I, TNNI3, TNNC1, CMH7, RCM1, cTnI, CMD2A, MGC116817.

  • Physical Appearance

    Sterile Filtered White lyophilized (freeze-dried) powder.

  • Stability

    Lyophilized TNNI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Cardiac Troponin I should be stored at 4°C between 2-7 days and for future use below -18°C.
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Please prevent freeze-thaw cycles.

  • Solubility

    It is recommended to reconstitute the lyophilized TNNI3 with urea /Tris buffer (20mM Tris, pH 7.5, 5 mM EDTA, 7 M urea and 15 mM 2-mercaptoethanol) not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

  • Amino Acid Sequence

    MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQ
    IAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEE
    RYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKE
    SLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Tnni3 Human

You may also like