PDI Human

PDI Human

Enzymes

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    PDI Human

    Description:

    Protein Disulfide Isomerase Human Recombinant

    Protein Disulfide Isomerase, PDI, EC 5.3.4.1, Prolyl 4-hydroxylase subunit beta, Cellular thyroid hormone-binding protein, p55, P4HB, ERBA2L, PDIA1, PO4DB, DSI, GIT, PHDB, PO4HB, PROHB, P4Hbeta.

    Product # :

    ENZ-262

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add :

  • description
  • source
  • formulation
  • purity
  • More Info

Description

PDI Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing a total of 502 amino acids and having a molecular mass of 56.6kDa. The PDI is fused to a 12 amino acid His tag at N-terminal and purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Formulation

The PDI protein (1mg/ml)solution was lyophilized from PBS pH-7.

Purity

Greater than 95.0% as determined by:
a) Analysis by RP-HPLC.
b) Analysis by SDS-PAGE.

More Info

  • Introduction

    Protein disulfide isomerases (PDIs) constitute a family of structurally related enzymes which catalyze disulfide bonds formation, reduction, or isomerization of newly synthesized proteins in the lumen of the endoplasmic reticulum (ER). They act also as chaperones, and are, therefore, part of a quality-control system for the correct folding of the proteins in the same subcellular compartment. PDI has been found to have moderate effects (25-fold) on the rate of oxidative folding of proteins in vitro.
    Recombinant Human Protein Disulfide Isomerase is involved in disulphide-bond formation and isomerization, as well as the reduction of disulphide bonds in proteins. Recombinant PDI has been found to have moderate effects (25-fold) on the rate of oxidative folding of proteins in vitro.

  • Synonyms

    Protein Disulfide Isomerase, PDI, EC 5.3.4.1, Prolyl 4-hydroxylase subunit beta, Cellular thyroid hormone-binding protein, p55, P4HB, ERBA2L, PDIA1, PO4DB, DSI, GIT, PHDB, PO4HB, PROHB, P4Hbeta.

  • Physical Appearance

    Sterile Filtered White lyophilized (freeze-dried) powder.

  • Stability

    Lyophilized Protein Disulfide Isomerase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Human PDI should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please avoid freeze-thaw cycles.

  • Solubility

    It is recommended to reconstitute the lyophilized PDI in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

  • Amino Acid Sequence

    MRGSGSHHHHHHAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKA

    AGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN

    WLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNS

    DVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIK

    THILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITL

    EEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEK

    KNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFP

    ASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL

  • Reductase Activity

    0.001 650nm/ min-2. By measuring the turbidity increase at 650 nm due to insulin reduction (Holmgren, A. (1979) J. Biol. Chem. 254, 9627–9632). The activity is expressed as the ratio of the slope of a linear part of the turbidity curve to the lag time (Mart

  • Isomerase Activity

    0.5 µmol active RNase A min-1 µmol PDI-1. According to the re-activation of reduced and denatured RNase A (Lyles, M. M. and Gilbert, H. F. (1991) Biochemistry 30, 613-619).

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Protein Disulfide Isomerase Human

You may also like