MOG Human

MOG Human

Myelin Oligodendrocyte Glycoprotein

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    MOG Human

    Description:

    Myelin Oligodendrocyte Glycoprotein Human Recombinant

    Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.

    Product # :

    PRO-466

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add :

  • description
  • source
  • formulation
  • purity
  • More Info

Description

Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.

Source

Escherichia Coli.

Formulation

The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5

Purity

Greater than 95.0% as determined by SDS-PAGE.

More Info

  • Introduction

    Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.

  • Synonyms

    Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.

  • Physical Appearance

    Sterile Filtered White lyophilized (freeze-dried) powder.

  • Stability

    Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

  • Solubility

    It is recommended to reconstitute the lyophilized MOG in sterile 50mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

  • Amino Acid Sequence

    MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN
    GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE
    EAAMELKVEDPFYWVSPGHHHHHH.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Mog Human

You may also like