IL 13 Human

IL 13 Human

Cytokines

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    IL 13 Human

    Description:

    Interleukin-13 Human Recombinant

    NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

    Product # :

    CYT-446

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add :

  • description
  • source
  • formulation
  • purity
  • biological activity
  • More Info

Description

Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Formulation

The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

Purity

Greater than 95% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Biological Activity

The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of >1 x 106units/mg.

More Info

  • Introduction

    IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

  • Synonyms

    NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

  • Physical Appearance

    Sterile Filtered White lyophilized (freeze-dried) powder.

  • Stability

    Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

  • Solubility

    It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

  • Amino Acid Sequence

    GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS
    GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE
    GRFN.

  • Protein content

    Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.57 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IL-13 as a Reference Standard.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Il 13 Human

You may also like

Frequently asked questions

1. Which company offers Recombinant cytokines at competitive prices?

ProSpec offers vast array of cytokines such as Interferon-alpha | Interleukin-2 | TNF-alpha | BMP-2 and much more at affordable descent prices to meet academic budgets.
ProSpec provides High Purity cytokines for 30 years, purity exhibits 95% or more by SDS-PAGE gel.
Cytokines are in stock for immediate delivery via FedEx which enables scientists and researchers to perform immediate experiments.
Cytokines are shipped globally using ProSpec’s custom tailored Styrofoam insulated box and premium ice packs that ensure maximum protein stability during transit to your laboratory.

2. Where can i find biologically active cytokines?

ProSpec offers biologically functional cytokines such as Adiponectin | Cardiotrophin | Beta Defensin which are rigorously tested in-vitro to provide researchers world wide BioActive Cytokines.