IFN a 2a Antibody

IFN a 2a Antibody

Other Polyclonal Antibodies

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    IFN a 2a Antibody

    Description:

    Interferon a 2a Polyclonal Rabbit Anti-Human Antibody

    Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.

    Product # :

    ANT-034

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add :

  • formulation
  • purity
  • More Info

Formulation

Lyophilized from 0.2μm sterile filtered solution in phosphate buffered saline, pH 7.4.

Purity

Greater than 98.0% as determined by Analysis by SDS-PAGE.

More Info

  • Introduction

    IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.

  • Synonyms

    Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.

  • Stability

    Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.

  • Solubility

    Reconstitute with H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.

  • Immunogen

    IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.

  • Applications

    ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/500 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a.

    Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,000.

  • Antigen Amino Acid Sequence

    CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

  • Type

    Polyclonal Rabbit Antibody.

  • Purification Method

    Purified IgG prepared by affinity chromatography on protein G.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Ifn A 2A Antibody

You may also like