HCV Genotype 1b, 170 a.a.

HCV Genotype 1b, 170 a.a.

Hepatitis C

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    HCV Genotype 1b, 170 a.a.

    Description:

    Hepatitis C Virus Nucleocapsid (core) Genotype-1b, 170 a.a Recombinant

    Product # :

    HCV-007

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add :

  • description
  • source
  • formulation
  • purity
  • More Info

Description

Recombinant HCV Core genotype 1b produced in E.Coli containing 170 amino acids and purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Formulation

Sterile filtered solution containing 1x PBS and 25mM Arginine.

Purity

Greater than 95.0% as determined by SDS-PAGE.

More Info

  • Introduction

    HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
    HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

  • Physical Appearance

    Sterile filtered colorless solution.

  • Stability

    Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

  • Amino Acid Sequence

    MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSSTNPKPQRKTKRNTNRRPQDV
    KFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGWRQPIPKARRPEGRAW
    AQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGF
    ADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPVDKLAAALEHHHHHH*

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Hcv Genotype 1B 170 Aa

You may also like