FKBP1A Human

FKBP1A Human

Enzymes

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    FKBP1A Human

    Description:

    FK506 Binding Protein 1A Human Recombinant

    FKBP12, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, FKBP-12, FKBP1, PKC12, PKCI2, FKBP12C, FKBP1A, PPIase FKBP1A, FK506-binding protein 1A, 12 kDa FKBP, FKBP-1A.

    Product # :

    ENZ-374

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add :

  • description
  • source
  • formulation
  • purity
  • More Info

Description

FKPB1A Human Recombinant fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain purified through a Ni2+-affinity chromatography followed by gel filtration.

Source

Escherichia Coli.

Formulation

The FKBP1A protein solution contains 50mM Hepes pH-8.0, 150mM NaCl, 0.5mM EDTA & 1mM sodium azide.

Purity

Greater than 99.0% as determined by SDS-PAGE.

More Info

  • Introduction

    FKBP1A is a 12kDa protein initialy discovered onin immune cells on the basis of its capability to bind and mediate the intracellular effect of the immunosuppressant FK506. FKBP1A is also known to mediate the action of Rapamycin-immunosuppressive agent. FKBP1A is part of the family of immunophilins, which have in common high affinity for immunosuppressant drugs and a peptidyl-prolyl cis-trans isomerase (PPIase). Activity which participates in folding of proline-containing protein. In the absence of immunosuppressive ligands, FKBP1A is involved in intracellular calcium regulation by associating with 3 types of Ca2+ release channel complexes: skeletal ryanodine receptors, cardiac ryanodine receptors and the inositol 1,4,5-triphosphate receptor. FKBP1A also interact with TGF-b type I receptor exerting an inhibitory effect on the TGF-b signaling pathway. FKBP12 plays a role in modulation of ryanodine receptor isoform-1 (ryr-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. FKBP1A increase the folding of proteins and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

  • Synonyms

    FKBP12, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, FKBP-12, FKBP1, PKC12, PKCI2, FKBP12C, FKBP1A, PPIase FKBP1A, FK506-binding protein 1A, 12 kDa FKBP, FKBP-1A.

  • Physical Appearance

    Sterile Filtered colorless solution.

  • Stability

    Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

  • Amino Acid Sequence

    The amino acid sequence of recombinant His-tagged FKBP12 is reported as following:
    MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVV
    HYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
    EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHAT
    LVFDVELLKLE.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Fkbp1A Human

You may also like