Search results
1000 results found for “anti viral monoclonal”
Name
Description
Product #
Price
Quantity
Shipping Method
- View Data Sheet
Name :
EGF AntibodyDescription:
Endothelial Growth Factor, Mouse Anti-Human
Urogastrone, URG, EGF.
Product # :
ANT-169Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide.
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. -
Synonyms
Urogastrone, URG, EGF.
-
Solubility
Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
r.HumanEGF.
-
Ig Subclass
Mouse IgG2b.
-
Clone
NYRhEGF.
-
Applications
Direct ELISA, Western Blot, Immuneprecipitation.
-
Titer
By direct ELISA, 1:10,000 dilution will yield 0.3 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4oC in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20oC.
-
Purification Method
Ion exchange.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
ADSL AntibodyDescription:
Adenylosuccinate Lyase, Mouse Anti Human
Adenylosuccinate lyase, ASL, Adenylosuccinase, ASase, ADSL, AMPS.
Product # :
ANT-623Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
Adenylosuccinate lyase (ADSL) is an enzyme which converts adenylosuccinate to AMP and fumarate as part of the purine nucleotide cycle. ADSL is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. ADSL catalyzes 2 reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to yield aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to yield AMP. Defects in the ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency). ADSL deficiency is an autosomal recessive disorder distinguished by the accumulation in the body fluids of succinylaminoimidazole-carboxamide riboside (SAICA-riboside) and succinyladenosine (S-Ado). Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and in some cases, growth retardation associated with muscle wasting and epilepsy.
-
Synonyms
Adenylosuccinate lyase, ASL, Adenylosuccinase, ASase, ADSL, AMPS.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human ADSL mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human ADSL protein 1-484 amino acids purified from E. coli.
-
Ig Subclass
Mouse IgG1 heavy chain and k light chain.
-
Clone
PAT16C10AT.
-
Applications
The antibody has been tested by ELISA, Western blot analysis, Flow cytometry and ICC/IF to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
ADSL antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS3 1bDescription:
Hepatitis C Virus NS3 Genotype-1b, (1356-1459 a.a.) Recombinant
Product # :
HCV-249Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to a 22kDa proprietary GST tag at N-Terminus.
Formulation
1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS3 Genotype-1b protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
NS3 Genotype-1b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS3 Genotype-1b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS3 Genotype-1b protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
ISG15 AntibodyDescription:
Interferon stimulated gene 15, Mouse Anti Human
ISG15, G1P2, IFI15, UCRP, Interferon-induced 17 kDa protein precursor, ISG15 Ubiquitin-like modifier.
Product # :
ANT-333Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.
More Info
-
Introduction
ISG15 ubiquitin-like Modifier is conjugated to the intracellular target proteins after IFN-alpha or IFN-beta stimulation. ISG15 enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the ub conjugation pathway at the level of a specific E2 enzyme. ISG15 protein targets include STAT1, SERPINA 3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MXA, and RIG-1. Deconjugated by USP18/UBP43 shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. ISG15 serves as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. ISG15 plays a role in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing ifn-gamma secretion by monocytes and macrophages. ISG15 displays a
-
Synonyms
ISG15, G1P2, IFI15, UCRP, Interferon-induced 17 kDa protein precursor, ISG15 Ubiquitin-like modifier.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Immunogen
Anti-human ISG15 mAb is derived from hybridization of mouse SP2/0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human ISG15 amino acids 1-157 purified from E. coli.
-
Ig Subclass
Mouse IgG1 heavy chain and κ light chain.
-
Clone
P3E5AT.
-
Applications
ISG15 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:1,000 ~ 2,000. Recommended starting dilution is 1:1,000.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
ISG15 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HSV-1 gGDescription:
Herpes Simplex Virus-1 gG Recombinant
Product # :
HSV-224Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the HSV-1 gG immunodominant regions, 84-175 amino acids and fused to a GST-Tag at C-terminus.
Formulation
25mM Tris-HCl pH 7.2, 1mM EDTA, and 50% glycerol.
Purity
HSV-1 gG protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Entry of HSV into the host cell involves interactions of several viral glycoproteins with cell surface receptors. The virus particle is covered by an envelope which, when bound to specific receptors on the cell surface, will fuse with the cell membrane and create an opening, or pore, through which the virus enters the host cell. The sequential stages of HSV entry are analagous to those of other viruses. At first, complementary receptors on the virus and cell surface bring the two membranes into proximity. In an intermediate state, the two membranes begin to merge, forming a hemifusion state. Finally, a stable entry pore is formed through which the viral envelope contents are introduced to the host cell.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
HSV-1 gG protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Specificity
Immunoreactive with sera of HSV-infected individuals.
-
Purification Method
HSV-1 gG was purified by Sepharose-Derived Purification.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
ACADS AntibodyDescription:
Acyl-Coenzyme A Dehydrogenase, C-2 to C-3, Mouse Anti Human
ACAD3, SCAD, EC 1.3.99.2, Short-chain specific acyl-CoA dehydrogenase, mitochondrial, Butyryl-CoA dehydrogenase, ACADS.
Product # :
ANT-689Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
ACADS is a tetrameric mitochondrial flavoprotein, which is part of the acyl-CoA dehydrogenase family. ACADS catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in ACADS have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.
-
Synonyms
ACAD3, SCAD, EC 1.3.99.2, Short-chain specific acyl-CoA dehydrogenase, mitochondrial, Butyryl-CoA dehydrogenase, ACADS.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human ACADS mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human ACADS amino acids 25-412 purified from E. coli.
-
Ig Subclass
Mouse IgG2a heavy chain and k light chain.
-
Clone
PAT8B10AT.
-
Applications
ACADS antibody has been tested by ELISA, Western blot analysis, Flow cytometry and ICC/IF to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
ACADS antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
IBV-NPDescription:
Influenza B Virus Nucleoprotein Recombinant
Product # :
IHA-038Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- More Info
Description
Recombinant Influenza B Virus Nucleoprotein produced in E. coli having a Mw of 76.8kDa. IBV-NP is fused to a 6xHis tag at its C terminal is and purified by proprietary chromatographic technique.
Source
E. coli.
Formulation
IBV-NP protein solution contains 25mM K2CO3 and PBS.
More Info
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
HMSNMDIDGMNTGTIDKTPEEITSGTSGTTRPIIRPATLAPPSNKRTRNPSPDRTTTSSE
DDVGRKAQKKQTPTEIKKSVYNMVVKLGEFYNQMMVKAGLNDDMERNLIQNAHAVERILL
AATDDKKTEFQKKKNARDVKEGKEEIDHNKTGGTFYKMVRDDKTIYFSPIRITFLKEEVKT
MYKTTMGSDGFSGLNHIMIGHSQMNDVCFQRSKALKRVGLDPSLISTFAGSTVPRRSGATGV
AIKGGGTLVAEAIRFIGRAMADRGLLRDIKAKTAYEKILLNLKNKCSAPQQKALVDQVIGSRN
PGIADIEDLTLLARSMVVVRPSVASKVVLPISIYAKIPQLGFNVEEYSMVGYEAMALYNMATP
VSILRMGDDAKDKSQLFFMSCFGAAYEDLRVLSALTGTEFKPRSALKCKGFHVPAKEQVEGMGA
ALMSIKLQFWAPMTRSGGNEVGGDGGSGQISCSPVFAVERPIALSKQAVRRMLSMNIEGRDADV
KGNLLKMMNDSMAKKTSGNAFIGKKMFQISDKNKTNPIEIPIKQTIPNFFFGRDTAEDYDDLDYLE.
-
Background
Influenza B virus, often overshadowed by its influenza A counterpart, remains a substantial contributor to seasonal influenza infections and poses a considerable public health challenge. In the quest for effective countermeasures, Influenza B Virus Nucleoprotein Recombinant has emerged as a focal point in the ongoing battle against this resilient virus. This research endeavors to unveil the intricacies of the Nucleoprotein Recombinant, delving into its structural nuances, immunogenic capabilities, and applications in vaccine development and antiviral therapies. By dissecting the properties of the Nucleoprotein Recombinant, scientists aspire to fortify our defenses against Influenza B, potentially reshaping strategies for broader influenza immunity.
Structural Insights into Nucleoprotein Recombinant:
Engineered to replicate key viral components, the Influenza B Virus Nucleoprotein Recombinant serves as a molecular mirror, allowing a comprehensive study of the virus's genetic material. Understanding its three-dimensional structure and conformational intricacies is crucial, not only for decoding the virus's replication mechanisms but also for tailoring interventions like vaccines and antiviral drugs to specific vulnerabilities.
Immunogenic Potential and Vaccine Development:
The challenge of Influenza B's seasonal variability necessitates innovative approaches to vaccine development. Nucleoprotein Recombinant, designed to induce potent immune responses, emerges as a promising candidate. By presenting conserved viral elements to the immune system, the recombinant protein seeks to instigate robust and durable immunity, countering the virus's propensity for antigenic drift and promoting broader protection.
Application in Antiviral Therapies:
In addition to its role in vaccination, the Influenza B Virus Nucleoprotein Recombinant holds potential in antiviral therapies. The recombinant protein's ability to provoke immune responses can be harnessed for the development of immunotherapies. Monoclonal antibodies derived from the Nucleoprotein Recombinant may offer targeted treatments, providing a dynamic approach to mitigating the impact of Influenza B infections.
Challenges and Future Directions:
Despite the promises held by the Nucleoprotein Recombinant, challenges persist. The virus's ability to undergo genetic reassortment and antigenic drift requires ongoing vigilance and adaptability in recombinant strategies. Considerations of vaccine safety, efficacy, and public acceptance demand continual exploration to optimize the translational success of Nucleoprotein Recombinant-based interventions.
Influenza B Virus Nucleoprotein Recombinant stands as a beacon in the scientific quest against influenza, offering a pathway to a more comprehensive and resilient immunity. Its structural insights, immunogenic potential, and applications in vaccine development and antiviral therapies position it as a central player. As researchers delve deeper into the molecular intricacies of Nucleoprotein Recombinant, they not only fortify our defenses against Influenza B but potentially pave the way for a paradigm shift in our approach to influenza prevention and control, influencing the landscape of global health preparedness.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
s100A11 AntibodyDescription:
S100 Calcium Binding Protein A11, Mouse Anti Human
Protein S100-A11, S100 calcium-binding protein A11, Calgizzarin, MLN 70, S100A11, MLN70, S100C.
Product # :
ANT-666Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
S100A11 is a member of the S100 family of proteins which contains two EF-hand calcium-binding motifs and is thought to be involved in the regulation of a number of cellular processes including cell cycle progression and differentiation. S100A11 may function in motility, invasion and tubulin polymerisation. S100 proteins are localized either in the cytoplasm or the nucleus of a wide range of cells. There are at least 13 members in the S100 gene family, which are located as a cluster on chromosome 1q21. Chromosomal rearrangements and altered expression of S100A11 have been implicated in tumor metastasis.
-
Synonyms
Protein S100-A11, S100 calcium-binding protein A11, Calgizzarin, MLN 70, S100A11, MLN70, S100C.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human s100A11 mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human s100A11 protein 1-105 amino acids purified from E. coli.
-
Ig Subclass
Mouse IgG1 heavy chain and k light chain.
-
Clone
PAT20D11AT.
-
Applications
The antibody has been tested by ELISA, Western blot analysis, Flow cytometry and ICC/IF to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
s100A11 antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
IAV-NPDescription:
Influenza A Virus Nucleoprotein Recombinant
Product # :
IHA-035Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
- sds-page
Description
Recombinant Influenza A Virus Nucleoprotein produced in E. coli having a Mw of 66.6kDa. IAV-NP is fused to a 6xHis tag at its C terminal is and purified by proprietary chromatographic technique.
Source
E. coli.
Formulation
IAV-NP protein solution contains 0.25% sodium azide, 10mM K2CO3 and PBS.
Purity
Protein is >90% pure as determined by 10% PAGE (coomassie staining).
sds-page
More Info
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGR LIQNSLTIERMVLSAFDERRNRYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELVL YDKEEIRRIWR QANNGDDATRGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMC SLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRGINDRNFWRGENGRKTRSAY ERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFSARSALILRGSVAHKS CLPACVYGPAVSSGYDFEKEGYSLVGIDPFKLLQNSQVYSLIRPNENPAHKSQLVWM ACHSAAFEDLRLLSFIRGTKVCPRGKLSTRGVQIASNENMDNMESSTLELRSRYWAIR TRSGGNTNQQRASAGQISVQPTFSVQRNLPFEKSTVMAAFTGNTEGRTSDMRAEIIRMM
-
Background
Influenza A virus, notorious for its ability to cause seasonal epidemics and occasional pandemics, poses a significant threat to global public health. The pursuit of effective countermeasures has led to the exploration of Influenza A Virus Nucleoprotein Recombinant as a key molecular protagonist in our defense against this elusive virus. This research endeavors to unravel the intricacies of the Nucleoprotein Recombinant, shedding light on its structural features, immunogenic prowess, and applications in vaccine development and antiviral therapies. By dissecting the properties of the Nucleoprotein Recombinant, scientists aim to fortify our defenses against Influenza A, potentially paving the way for a new era in influenza prevention and control.
Structural Insights into Nucleoprotein Recombinant:
The Influenza A Virus Nucleoprotein Recombinant, engineered to mirror crucial viral components, serves as a versatile tool for studying the virus's genetic material. A nuanced understanding of its three-dimensional structure and conformational intricacies is pivotal, not only for deciphering the virus's replication mechanisms but also for designing targeted interventions, such as vaccines and antiviral drugs.
Immunogenic Potential and Vaccine Development:
The quest for an effective influenza vaccine has been fueled by the virus's notorious mutability. Nucleoprotein Recombinant, designed to elicit strong immune responses, stands as a promising candidate for vaccine development. By presenting conserved viral elements to the immune system, the recombinant protein aims to induce robust and lasting immunity, thwarting the influenza virus's ability to evade immune detection through antigenic drift.
Application in Antiviral Therapies:
Beyond vaccination, Influenza A Virus Nucleoprotein Recombinant holds promise in the realm of antiviral therapies. The recombinant protein's ability to stimulate immune responses can be harnessed in the development of immunotherapies. Monoclonal antibodies derived from the Nucleoprotein Recombinant may offer targeted treatments, neutralizing the virus and potentially shortening the duration and severity of influenza infections.
Challenges and Future Directions:
While the Nucleoprotein Recombinant stands at the forefront of influenza research, challenges persist. The virus's ability to rapidly mutate demands ongoing vigilance and adaptability in recombinant strategies. Furthermore, considerations of vaccine safety, efficacy, and public acceptance necessitate continuous exploration to optimize the translational success of Nucleoprotein Recombinant-based interventions.
Influenza A Virus Nucleoprotein Recombinant emerges as a sentinel in the scientific arsenal against influenza, epitomizing the quest for innovative solutions in the face of viral challenges. Its structural insights, immunogenic potential, and applications in vaccine development and antiviral therapies position it as a pivotal player. As researchers continue to decipher the molecular intricacies of Nucleoprotein Recombinant, they not only fortify our defenses against influenza but potentially pave the way for a paradigm shift in our approach to influenza prevention and control, shaping the landscape of global health security.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CRADD AntibodyDescription:
Caspase and RIP Adapter with Death Domain, Mouse Anti Human
RAIDD, MGC9163, CRADD, Death domain-containing protein CRADD, Caspase and RIP adapter with death domain, RIP-associated protein with a death domain, CASP2 and RIPK1 domain containing adaptor with death domain.
Product # :
ANT-553Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
CRADD is a 22kDa, widely-expressed cytosolic adaptor/signaling protein that induces cell apoptosis/cell death in numerous tissues. CRADD is a death domain (CARD) that recruits, caspase 2/ICH1 to the cell death signal transduction complex that includes TNFR1A, RIPK1/RIP kinase, and numbers of other CARD domain-containing proteins.
-
Synonyms
RAIDD, MGC9163, CRADD, Death domain-containing protein CRADD, Caspase and RIP adapter with death domain, RIP-associated protein with a death domain, CASP2 and RIPK1 domain containing adaptor with death domain.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human CRADD mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human CRADD protein 1-199 amino acids purified from E. coli.
-
Ig Subclass
Mouse IgG1 heavy chain and k light chain.
-
Clone
PAT14G8AT.
-
Applications
CRADD antibody has been tested by ELISA, Western blot and ICC/IF analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
CRADD antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
NAP 2 AntibodyDescription:
Natural anti-proliferative protein, Mouse-Anti Human
Platelet basic protein, PBP, Small inducible cytokine B7, CXCL7, Leukocyte-derived growth factor, LDGF, Macrophage-derived growth factor, MDGF, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), TC1, TC2, TGB, TGB1, B-TG1, CTAP3, NAP-2, SCYB7, THBGB, LA-PF4, THBGB1, Beta-TG, CTAPIII, CTAP-III.
Product # :
ANT-170Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
Chemokine (C-X-C motif) ligand (CXCL7) is a small cytokine belonging to the CXC chemokine family. It is a protein that is released in large amounts from platelets following their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator.
-
Synonyms
Platelet basic protein, PBP, Small inducible cytokine B7, CXCL7, Leukocyte-derived growth factor, LDGF, Macrophage-derived growth factor, MDGF, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), TC1, TC2, TGB, TGB1, B-TG1, CTAP3, NAP-2, SCYB7, THBGB, LA-PF4, THBGB1, Beta-TG, CTAPIII, CTAP-III.
-
Solubility
Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
r.Human NAP-2.
-
Ig Subclass
Mouse IgG1.
-
Clone
NYRhNAP-2.
-
Applications
Direct ELISA, Western Blot, Immuneprecipitation.
-
Note
This antibody will bind very well to protein A in a buffer (PBS) containing high salt concentration (3M Nacl).
-
Titer
In direct ELISA, using alkaline phosphatase goat anti-mouse Ig (Jackson Laboratories) 1:10,000 dilution will yield 0.5 O.D within 10 minutes.
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4oC in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20oC.
-
Purification Method
ion exchange.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
MHC Class II AntibodyDescription:
MHC Class II, Mouse Anti-Human
Product # :
ANT-296Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
MHC Class II is consists of 2 membrane spanning proteins. Each of these proteins is roughly 30 kDa, and has of two Globular domains, Alpha-1, Alpha-2, Beta-1 and Beta-2. The two regions farthest away from the membrane are alpha-1 and beta-1. The two proteins link without Covalent Bonds. The MHC Class II protein mainly presents peptides, which have been digested from external sources. MHC Class II is normally only expressed by Antigen Presenting Cells (APC) which digest foreign protein. Within the RER the alpha and beta proteins of the molecule, associate with each other, while a third protein called the "invariant chain," is necessary for stabilizing the complex, without it, they will not associate. The MHC-invariant complex is then passed from the RER, into and out of, the Golgi body. It fuses with an Endocytic compartment, where an external protein has been sampled and degraded.
-
Solubility
Reconstitute with sterile H20 to give a 1mg/ml concentration. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Purified Human B cells.
-
Ig Subclass
Mouse IgG2a.
-
Clone
CYR-hClass II.
-
Applications
FACS staining, Western Blot, Immuneprecipitation.
-
Specificity
All haplotypes.
-
Titer
Staining antibody. For staining, use 10µl/1,000,000 cells.
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Available Conjugates
This antibody is currently available only as purified antibody.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
Lyophilized: store at 4°C. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Ion exchange column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CoV-2 Spike E-MosaicDescription:
Coronavirus 2019 Spike E-Mosaic Recombinant
Product # :
SARS-014Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the Coronavirus 2019 spike Envelope Mosaic immunodominant regions having a Mwq of 40.5 kDa, fused to 6xHis tag at C-terminal.
Source
Escherichia Coli.
Formulation
CoV 2019 Spike E-Mosaic Protein 1mg/ml solution is supplied in 1x PBS.
Purity
CoV 2019 Spike E-Mosaic Protein is >90% pure as determined SDS-PAGE.
More Info
-
Introduction
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.
The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.
While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
CoV 2019 Spike E-Mosaic Protein is shipped on ice packs. Upon arrival, Store at -20°C.
-
Amino Acid Sequence
S-part (20-210 a.a.)
RTQLPPAYTN SFTRGVYYPD KVFRSSVLHS TQDLFLPFFS NVTWFHAIHV SGTNGTKRFD NPVLPFNDGV YFASTEKSNI IRGWIFGTTL DSKTQSLLIV NNATNVVIKV CEFQFCNDPF LGVYYHKNNK SWMESEFRVY SSANNCTFEY VSQPFLMDLE GKQGNFKNLR EFVFKNIDGY FKIYSKHTPI
E-part (51-75 a.a.)
AYCCNIVNVS LVKPSFYVYS RVKNLNSSRV PDLLV
M part (100-222 a.a.)
RLFARTRSMW SFNPETNILL NVPLHGTILT RPLLESELVI GAVILRGHLR IAGHHLGRCD
IKDLPKEITV ATSRTLSYYK LGASQRVAGD SGFAAYSRYR IGNYKLNTDH SSSSDNIALL VQ
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
VAMP3 AntibodyDescription:
Synaptobrevin-3, Mouse Anti Human
VAMP3, VAMP-3, Cellubrevin, Vesicle-Associated Membrane Protein 3, Synaptobrevin-3, CEB, SYB3.
Product # :
ANT-352Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.
More Info
-
Introduction
VAMP3 is present in recycling endosomes and endosome-derived vesicles. VAMP3 has been implicated in recycling of transferrin receptors to the plasma membrane, secretion of alpha-granules in platelets, recycling of T-cell receptors to the immunological synapses, and membrane trafficking during cell migration. VAMP-3 is present in human platelets and necessary for granule secretion. Synaptobrevins are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. VAMP3 high homology to other VAMPs in its broad tissue distribution and subcellular localization is shown to be the human equivalent of the rodent cellubrevin. In platelets the protein resides on a compartment that is not mobilized to the plasma membrane on calcium or thrombin stimulation.
-
Synonyms
VAMP3, VAMP-3, Cellubrevin, Vesicle-Associated Membrane Protein 3, Synaptobrevin-3, CEB, SYB3.
-
Immunogen
Anti-human VAMP3 mAb is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human VAMP3 amino acids 1-77 purified from E. coli.
-
Ig Subclass
Mouse IgG2b heavy chain and κ light chain.
-
Clone
Pk2A2AT.
-
Applications
VAMP3 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:1,000 ~ 2,000. Recommended starting dilution is 1:1,000.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
VAMP3 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Ig Kappa antibodyDescription:
Ig Kappa Light Chain, Mouse Anti-Human
Product # :
ANT-202Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Solubility
Reconstitute with H20 to get a 1 mg/ml concentration. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Purified hIgG Kappa.
-
Ig Subclass
Mouse IgG2a.
-
Titer
By direct ELISA, 1:10,000 dilution will yield 0.75 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4°C in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.Please prevent freeze-thaw cycles.
-
Purification Method
Ion exchange column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
LY6G AntibodyDescription:
LY6G, Rat Anti Mouse Antibody
Lymphocyte antigen 6G, Ly-6G, Ly-6G.1, Ly6g, Gr1, Gr-1.
Product # :
ANT-158Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
Myeloid differentiation antigen Gr1 (Ly6G) is a GPI-anchored protein, which is briefly expressed on monocytes in the bone marrow. The level of the Ly6G expression in the bone marrow completely correlates with granulocyte differentiation and maturation. Ly6G ligation on murine neutrophils inhibits neutrophil recruitment, thus providing the first evidence of a function for the Ly6G molecule. Ly6G is seen primarily on neutrophils, also in a subgroup of eosinophils, differentiating pre-monocytes and plasmacytoid dendritic cells.
-
Synonyms
Lymphocyte antigen 6G, Ly-6G, Ly-6G.1, Ly6g, Gr1, Gr-1.
-
Solubility
Reconstitute with H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Ly-6G-transfected cell line.
-
Ig Subclass
Rat IgG2a.
-
Clone
YRmLy-6G.
-
Applications
Flow cytometry, immunohistochemistry, cell depletion.
This antibody recognizes only Ly-6G which is expressed on most myeloid cells in the bone marrow and all peripheral granulocytes. For flow cytometry, use 10 µl/106 cells. Exact titer for cell depletion in vivo (cytotoxicity) should be determined by the investigator. -
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Available Conjugates
This antibody is also available conjugated to biotin and FITC.
-
Type
Rat Anti Mouse Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4°C in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Protein A column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CSK AntibodyDescription:
C-Src Tyrosine Kinase, Mouse Anti Human
Tyrosine-protein kinase CSK, C-Src kinase, Protein-tyrosine kinase CYL, CSK, C-Src Tyrosine Kinase.
Product # :
ANT-693Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
C-Src Tyrosine Kinase, also known as CSK, regulates cell growth, migration, differentiation, and immune response. CSK Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases. CSK is a protein coding gene which suppresses signaling by several surface receptors. Among CSK's related pathways are PI-3K cascade and Signaling by FGFR.
-
Synonyms
Tyrosine-protein kinase CSK, C-Src kinase, Protein-tyrosine kinase CYL, CSK, C-Src Tyrosine Kinase.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human CSK mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human CSK amino acids 1-450 purified from E. coli.
-
Ig Subclass
Mouse IgG2b heavy chain and κ light chain.
-
Clone
PAT7C6AT.
-
Applications
CSK antibody has been tested by ELISA, Western blot analysis and ICC/IF to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
CSK antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
MIP 3 AntibodyDescription:
Macrophage Inflammatory Protein-3, Mouse Anti-Human
C-C motif chemokine 23, Small-inducible cytokine A23, Macrophage inflammatory protein 3, Myeloid progenitor inhibitory factor 1, CK-beta-8, MIP-3, MPIF-1, CKB-8, CCL23, MIP3, MPIF1, SCYA23, CKb8, Ckb-8-1.
Product # :
ANT-121Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
CCL23 (MIP-3) is a ligand for the CCR1chemokine receptor. CCL23 is one of several cytokine genes clustered on the q-arm of chromosome 17, in a locus containing several other CC chemokines. MIP-3 chemoattracts monocytes, resting T-lymphocytes and neutrophils, but not activated lymphocytes. Furthermore, it was shown that MIP-3 inhibits colony formation of bone marrow myeloid immature progenitors. MIP-3 is mainly expressed in lung and liver tissue, but can be also found in bone marrow and placenta, as well as in some cell lines of myeloid origin.
Alternative splicing of the CCL23 gene produces 2 mRNAs which encode a short (CK?8) and a long (CK?81) isoform of the MIP-3. CK?8 cDNA encodes a 120 amino acid residue precursor protein with a putative 21 a.a. residue signal peptide which is cleaved to generate a 99 a.a. residue mature CK?8 (a.a. 22-120). Further N-terminal processing of the 99 a.a. residue variant can produce a 75 a.a. residue CK?8 (a.a. 46-120) which is considerably more active than the 99 a.a. residue variant.
MIP-3 may be involved in the malignant progression of certain human cancer cells which overexpress ErbB2 through the transactivation of ErbB2 tyrosine kinase. MIP-3 may also be involved in angiogenesis via upregulation of matrix metalloproteinase MMP-2 expression. -
Synonyms
C-C motif chemokine 23, Small-inducible cytokine A23, Macrophage inflammatory protein 3, Myeloid progenitor inhibitory factor 1, CK-beta-8, MIP-3, MPIF-1, CKB-8, CCL23, MIP3, MPIF1, SCYA23, CKb8, Ckb-8-1.
-
Solubility
Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
r.Human MIP-3.
-
Ig Subclass
Mouse IgG1.
-
Clone
YNR-HMIP3.
-
Titer
By direct ELISA, 1:10,000 dilution will yield 0.5 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4°C in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Ion exchange.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
MEMO1 AntibodyDescription:
Mediator of Cell Motility 1, Mouse Anti Human
Protein MEMO1, C21orf19-like protein, Hepatitis C virus NS5A-transactivated protein 7, HCV NS5A-transactivated protein 7, Mediator of ErbB2-driven cell motility 1, Mediator of cell motility 1, Memo-1, MEMO1, C2orf4, MEMO, NS5ATP7, CGI-27.
Product # :
ANT-090Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.
More Info
-
Introduction
Mediator of ErbB2-driven cell motility 1 (MEMO1) is a member of the UPF0103 family. MEMO1 regulates cell migration by transmitting extracellular chemotactic signals to the microtubule cytoskeleton. Furthermore, MEMO1 controls the localization of APC and CLASP2 to the cell membrane, using the regulation of GSK3B activity. MEMO1 is essential for breast carcinoma cell migration, suggesting a key role in tumorigenesis. MEMO1 is also a mediator of ERBB2 signaling.
-
Synonyms
Protein MEMO1, C21orf19-like protein, Hepatitis C virus NS5A-transactivated protein 7, HCV NS5A-transactivated protein 7, Mediator of ErbB2-driven cell motility 1, Mediator of cell motility 1, Memo-1, MEMO1, C2orf4, MEMO, NS5ATP7, CGI-27.
-
Immunogen
Anti-human MEMO1 mAb, is derived from hybridization of mouse FO myeloma cells with spleen cells from BALB/c mice immunized with recombinant human MEMO1 amino acids 1-297 purified from E. coli.
-
Ig Subclass
Mouse IgG1 heavy chain and kappa light chain.
-
Clone
P1E9AT.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
MEMO1 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
MAFK AntibodyDescription:
V-maf Musculoaponeurotic Fibrosarcoma Oncogene K, Mouse Anti Human
NFE2U, P18, Erythroid transcription factor NF-E2 p18 subunit, MAFK, Transcription factor MafK.
Product # :
ANT-463Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
MAFK is a member of the bZIP family and Maf subfamily. Members from Maf family of basic region/leucine zipper (bZIP) transcription factors influence transcription in a positive or negative way, depending on their protein associate and the context of the target promoter. Small Mafs act as transcriptional repressors when they dimerize among themselves. Yet, they seem to function as transcriptional activators by dimerizing with other basic-zipper proteins and employing them to specific DNA-binding sites.
-
Synonyms
NFE2U, P18, Erythroid transcription factor NF-E2 p18 subunit, MAFK, Transcription factor MafK.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Immunogen
Anti-human MAFK mAb, clone PAT2F7A, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human MAFK protein 1-156 amino acids purified from E. coli.
-
Ig Subclass
Mouse IgG2a heavy chain and Kappa light chain.
-
Clone
PAT2F7A.
-
Applications
The antibody has been tested by ELISA, Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended starting dilution is 1:1000.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
MAFK antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CACYBP AntibodyDescription:
Calcyclin Binding Protein, Mouse Anti Human
S100A6BP, S100A6 Binding Protein, GIG5, PNAS-107, RP1-102G20.6, SIP, CACYBP, hCacyBP, Siah-interacting protein, MGC87971.
Product # :
ANT-541Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
CACYBP (calcyclin binding protein) participates in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. CACYBP acts as a molecular bridge in ubiquitin E3 complexes. CACYBP is involved in the ubiquitin-mediated degradation of beta-catenin.
-
Synonyms
S100A6BP, S100A6 Binding Protein, GIG5, PNAS-107, RP1-102G20.6, SIP, CACYBP, hCacyBP, Siah-interacting protein, MGC87971.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human CACYBP mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human CACYBP protein 1-185 amino acids purified from E. coli.
-
Ig Subclass
Mouse IgG2a heavy chain and k light chain.
-
Clone
PAT3G8AT.
-
Applications
CACYBP antibody has been tested by ELISA, Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended starting dilution is 1:1000.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
CACYBP antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Description:
MHC Class II, (I-A) Mouse Antibody, FITC
Product # :
ANT-270Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
MHC Class II is consists of 2 membrane spanning proteins. Each of these proteins is roughly 30 kDa, and has of two Globular domains, Alpha-1, Alpha-2, Beta-1 and Beta-2. The two regions farthest away from the membrane are alpha-1 and beta-1. The two proteins link without Covalent Bonds. The MHC Class II protein mainly presents peptides, which have been digested from external sources. MHC Class II is normally only expressed by Antigen Presenting Cells (APC) which digest foreign protein. Within the RER the alpha and beta proteins of the molecule, associate with each other, while a third protein called the "invariant chain," is necessary for stabilizing the complex, without it, they will not associate. The MHC-invariant complex is then passed from the RER, into and out of, the Golgi body. It fuses with an Endocytic compartment, where an external protein has been sampled and degraded.
-
Solubility
Reconstitute with of H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Purified mouse LN B cells (C3H anti-C57Bl6).
-
Ig Subclass
Mouse IgG2a.
-
Clone
NYRmI-A.
-
Applications
Cytotoxic and staining antibody. For staining, use 10ml/1,000,000 cells. Titer for cytotoxicity should be determined by the investigator.
-
Specificity
Recognizes most MHC class II haplotypes (b,f,p,q,r,s,u,v), but weak against I-Ak.
-
Available Conjugates
This antibody is also available unconjugated and conjugated to Biotin.
-
Type
Mouse Antibody Monoclonal.
-
Storage Procedures
Lyophilized: store at 4°C. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Ion exchange column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
LYVE1 AntibodyDescription:
Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, Mouse Anti Human
Lymphatic vessel endothelial hyaluronic acid receptor 1 precursor, LYVE-1, Cell surface retention sequence-binding protein 1, CRSBP-1, Hyaluronic acid receptor, Extracellular link domain-containing protein.
Product # :
ANT-322Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.02% Sodium Azide and 10% Glycerol.
More Info
-
Introduction
LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.
-
Synonyms
Lymphatic vessel endothelial hyaluronic acid receptor 1 precursor, LYVE-1, Cell surface retention sequence-binding protein 1, CRSBP-1, Hyaluronic acid receptor, Extracellular link domain-containing protein.
-
Immunogen
Anti-human LYVE1 mAb is derived from hybridization of mouse SP2/O myeloma cells with spleen cells from BALB/c mice immunized with recombinant human LYVE1 amino acids 25-235 purified from E. coli.
-
Ig Subclass
Mouse IgG2b heavy chain and κ light chain.
-
Clone
P4G1AT.
-
Applications
LYVE1 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:500 ~ 1,000. Recommended starting dilution is 1:1,000.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
LYVE1 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H9N2 Hong-KongDescription:
H9N2 Influenza-A Virus Hong-Kong/1073/99 Recombinant
Product # :
IHA-013Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H9N2 A/Hong-Kong/1073/99 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells and its Mw is 72,000 dalton. The accession number is AJ404626.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H9N2 A/Hong-Kong/1073/99 solution contains 10mM Sodium Phosphate, pH 7.0 and 150mM NaCl and 0.01% Tween-20.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H9N2 is a subtype of the species Influenza A virus, whereas the PB1 and PB2 genes are closely related to those of the H5N1viruses and a quailH9N2 virus A/quail/Hong Kong/G1/97 (Qa/HK/G1/97) suggesting that many of the 1997chicken H9 isolates in the markets were reassortants.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
A/H9N2 Hong-Kong/1073/99 Recombinant should be stored at 4°C.
-
Immunological Activity
Western-Blot 0.1µg -1µg per strip, ELISA 1µg/Well.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.