Search results
1000 results found for “papillomavirus”
Name
Description
Product #
Price
Quantity
Shipping Method
- View Data Sheet
Description:
Mouse Anti SARS Nucleocapsid Horseradish Peroxidase
Product # :
ANT-765Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
SARS Nucleoprotein HRP antibody clone PT3851 is specific for the nucleocapsid SARS-CoV protein and recognizes the nucleoprotein of SARS-CoV-2 by ELISA.
Formulation
1mg/ml in DPBS, 1% BSA and 0.1% Proclin 950.
Purity
Greater than 90% as determined by SDS-PAGE gel.
More Info
-
Introduction
SARS Coronavirus is an enveloped virus containing three outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein plays an important role in virus infection cycle and is the primary target of neutralizing antibodies.It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.
-
Physical Appearance
Sterile Filtered liquid formulation.
-
Stability
Store at 4°C, stable for 2 weeks. For long-term storage, store at -20°C.
-
Immunogen
Recombinant protein fragment 1-49 a.a. of the SARS nucleoprotein.
-
Clone
PT3851
-
Applications
ELISA.
-
Isotype
Mouse IgG2b.
-
Type
Mouse antibody Monoclonal.
-
Purification Method
Protein A affinity purified.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
VWA2 HumanDescription:
Von Willebrand Factor A Domain Containing 2 Human Recombinant
A domain-containing protein similar to matrilin and collagen, AMACO, Colon cancer secreted protein 2, CCSP-2.
Product # :
PRO-2752Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
VWA2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 177 amino acids (341-517 a.a) and having a molecular mass of 19.3kDa.The VWA2 is expressed with an amino-terminal hexahistidine tag and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The VWA2 protein solution contains 20mM Tris-HCl, pH 8.0, 0.8M Urea & 50% glycerol.
Purity
Greater than 95% as determined by SDS-PAGE.
More Info
-
Introduction
Von Willebrand Factor A Domain Containing 2 (VWA2) is an extracellular matrix protein containing vWA-like domains. VWA2 contains a signal peptide sequence, an N-terminal VWA domain connected to 2 additional tandem vWA domains by a cysteine-rich sequence and an EGF-like domain. Also, another EGF-like domain is located at the C-terminus. Expression of VWA2 is induced in stage II, III and IV colon cancers and colon adenomas and is considered a novel serum marker for the diagnosis of early-stage colon cancer.
-
Synonyms
A domain-containing protein similar to matrilin and collagen, AMACO, Colon cancer secreted protein 2, CCSP-2.
-
Physical Appearance
Sterile Filtered colorless liquid formulation.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Oropouche-NPDescription:
Oropouche Virus Nucleoprotein Recombinant
Product # :
ORV-001Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Oropouche Virus Nucleoprotein produced in E.Coli is a single, non-glycosylated, polypeptide chain having a molecular mass of 23kDa. The Oropouche Virus Nucleoprotein is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
(1mg/1ml) in phosphate buffer saline and 25mM k2co3.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Recombinant Oropouche-NP although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Background
Oropouche virus also known as OROV which is a part of the Peribunyaviridae, genus Orthobunyavirus family is an arthropod-borne virus. OROV transmitted to humans through the bite of infected mosquitoes, with Culicoides and Aedes species being the most common vectors. OROV is very popular in South America, mainly in Brazil and is associated with outbreaks of febrile illness, often accompanied by symptoms such as headache, muscle and joint pains and retro-orbital pain. The nucleoprotein (N) of OROV plays a main role in the virus's lifecycle by forming part of the viral ribonucleoprotein complex that encapsidates the viral RNA genome and is involved in different stages of viral replication.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CHIKV MutantDescription:
Chikungunya Mutant (A226V) E1 Recombinant
Product # :
CHI-002Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Chikungunya Mutant (A226V) E1 produced in Insect Cells is a polypeptide chain containing amino acids 1-415, however at position 226 the Alanine of the wild-type CHIKV E1 gene was mutated to Valine. The molecular weight of the CHIKV Mutant is approximately 50kDa. The E1 protein is C-terminal part of E2-6K-E1 protein region. CHIKV Mutant is purified by proprietary chromatographic technique.
Source
Insect cells.
Formulation
CHIKV Mutant protein solution in 1xD-PBS, pH7.4, 0.1% Thimerosal, 5mM EDTA, 1µg/ml of Leupeptin, Aprotinin and Pepstatin A.
Purity
Protein is >95% pure as determined by 12.5% SDS-PAGE.
More Info
-
Introduction
Chikungunya is an infection caused by the chikungunya virus which is passed to humans by two species of mosquito of the genus Aedes: A. albopictus and A. aegypti. Animal reservoirs of the virus include monkeys, birds, cattle, and rodents. The features of the disease are a sudden onset of fever 2-4 days after exposure. The fever typically lasts 2-7 days, while the associated joint pains usually last weeks or months but sometimes years. The mortality rate is a little less than 1 in 1,000. The disease has occurred in outbreaks in Asia, Europe and the Americas since 2004. CHIKV is a single-stranded positive-sense RNA genome, 11,800 nts long which encodes 2 open reading frames. The nucleocapsid is tightly enveloped by a host-derived lipid bilayer (envelope) supporting the virus-encoded envelope proteins. 80 glycoprotein spikes are C- terminally anchored within the viral envelope. The structural polyprotein is translated from a viral sub genomic mRNA, while as the 5 structural proteins (capsid, E3, E2, 6K, E1) are translated as a single polyprotein, from which capsid (C) is cleaved off to encapsidate. The envelope polyprotein precursor E3-E2-6K-E1 is translocated to the endoplasmatic reticulum. Polyprotein is processed by host signalases, resulting in E3, E2 & E1 forming viral hetero-trimeric spikes. The viral spikes majorly contains E2 and E1 facilitate cell receptor recognition, cell entry thru pH-dependent endocytosis and support viral budding.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
YEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYVKCC
GTAECKDKNLPDYSCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFASAYRAHT
ASASAKLRVLYQGNNITVTAYANGDHAVTVKDAKFIVGPMSSAWTPFDNKIVVYKGDVYNMDYP
PFGAGRPGQFGDIQSRTPESKDVYANTQLVLQRPAVGTVHVPYSQAPSGFKYWLKERGASLQHT
APFGCQIATNPVRAVNCAVGNMPISIDIPEAAFTRVVDAPSLTDMSCEVPACTHSSDFGGVAII
KYAASKKGKCAVHSMTNAVTIREAEIEVEGNSQLQISFSTALASAEFRVQVCSTQVHCAAECHP
PKDHIVNYPASHTTLGQDISATAMSWVQKITGG.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H7N7 NetherlandsDescription:
H7N7 Influenza-A Virus Netherlands/219/03 Recombinant
Product # :
IHA-009Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H7N7 A/Netherlands/219/03 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells and its Mw is approximately 70,000 Dalton.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H7N7 A/Netherlands/219/03 solution contains 10mM Sodium phosphate, pH 7 and 150mM NaCl.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
H7N7 A/Netherlands/219/03 Recombinant should be stored at 4°C.
-
Immunological Activity
Western-Blot 0.1µg -1µg per strip, ELISA 1µg/Well.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H9N2 Hong-KongDescription:
H9N2 Influenza-A Virus Hong-Kong/1073/99 Recombinant
Product # :
IHA-013Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H9N2 A/Hong-Kong/1073/99 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells and its Mw is 72,000 dalton. The accession number is AJ404626.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H9N2 A/Hong-Kong/1073/99 solution contains 10mM Sodium Phosphate, pH 7.0 and 150mM NaCl and 0.01% Tween-20.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H9N2 is a subtype of the species Influenza A virus, whereas the PB1 and PB2 genes are closely related to those of the H5N1viruses and a quailH9N2 virus A/quail/Hong Kong/G1/97 (Qa/HK/G1/97) suggesting that many of the 1997chicken H9 isolates in the markets were reassortants.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
A/H9N2 Hong-Kong/1073/99 Recombinant should be stored at 4°C.
-
Immunological Activity
Western-Blot 0.1µg -1µg per strip, ELISA 1µg/Well.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 gp41 LongDescription:
HIV-1 gp41 Long Recombinant
Product # :
HIV-113Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 395 amino acids (444-833) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus.
Source
Escherichia Coli.
Formulation
8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Purity
Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
More Info
-
Introduction
Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
-
Physical Appearance
Sterile filtered colorless clear solution.
-
Stability
HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Amino Acid Sequence
IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
-
Specificity
Immunoreactive with all sera of HIV-1 infected individuals.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HSV-2 gD (31-335)Description:
Herpes Simplex Virus-2 gD (31-335 a.a.) Recombinant
Product # :
HSV-230Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
E.Coli derived HSV-2 gD recombinant protein, amino acids 31-335.
Source
Escherichia Coli.
Formulation
(1mg/1ml) in 1 X PBS.
Purity
Protein is >95% pure as determined by SDS-PAGE
More Info
-
Introduction
Receptors across the cell membrane interact with some viral glycoproteins therefor enabling HSV to enter the host cell. The HSV enter through pores created by the binding of particular receptors across the cell membrane with the virus's coating envelope, following by a fusion of the HSV and the host cell. HSV enters the host cell through the same mechanism and stages as other viruses do. Initially, matching receptors across the virus's envelope and host cell's membrane interacts and bring the two together. During the transitional stage, begins fusion between the host cell and virus (hemifusion state). The closing stage happens when a steady pore was made; through these pores the virus's particles enter the cell.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
HSV-2 gD although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
ELISA & WB.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Chlamydia W4Description:
Chlamydia Trachomatis W4 Recombinant
Product # :
CHT-002Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant 6xHis fusion at C-terminus protein contains Chlamydia Trachomatis MOMP protein epitopes, 191-286 amino acids.
Source
Escherichia Coli.
Formulation
(1mg/1ml) 20mM Tris-HCl, pH 7.2, 50% glycerol and 1.5M urea.
Purity
Protein is >90% pure as determined by SDS PAGE.
More Info
-
Introduction
Chlamydia is a common term for infection with any bacterium belonging to the phylum Chlamydiae. This term derives from the name of the bacterial genus Chlamydiain the family Chlamydiaceae, order Chlamydiales, class and phylum Chlamydiae. There are two genera in Chlamydiaceae: Chlamydia and Chlamydophila. The genus Chlamydia includes three species: C. trachomatis, C. muridarum, and C. suis.
-
Stability
Chlamydia W4 protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
ELISA, WB and Flow-Through.
-
Specificity
Immunoreactive with sera of Chlamydia Trachomatis W4-infected individuals.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 gp41Description:
HIV-1 gp41 Recombinant
Product # :
HIV-112Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HIV-1 env gp41 Strain IIIB is a non-glycosylated 288 amino acids polypeptide chain (a.a. 466-753) having a molecular mass of 32kDa. The protein is fused to B-galactosidase (114 kDa) at the N- terminus.
Source
Escherichia Coli.
Formulation
8M urea, 20mM Tris-HCl pH 8.0, 10mM B-mercaptoethanol.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
-
Physical Appearance
Sterile filtered colorless clear solution.
-
Stability
HIV-1 gp41 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue NS1, ST3Description:
Dengue Virus NS1 Recombinant, Subtype-3
Product # :
DEN-016Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the NS1 Dengue Virus full length Type-3 immunodominant regions, migrates as 45kDa on 12% SDS-PAGE gel.The dengue protein is fused to a 6xHis tag at C-terminus.
Source
Escherichia Coli.
Formulation
Phosphate buffered saline and 50mM arginine.
Purity
Protein is >90% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Dengue NS1, ST3 although stable at 4°C for 1 week, should be stored below -18°C.Please prevent freeze thaw cycles.
-
Applications
Immunoassay.
-
Purification Method
Purified by proprietary chromatographic technique
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV Core NS3Description:
Hepatitis C Virus Nucleocapsid (core) NS3 Recombinant
Product # :
HCV-008Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant HCV protein produced in E.Coli containing the Core (130 a.a.) and NS3 (236 a.a.) excluding NS4 and NS5 domains having a total Mw of 45kDa and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Sterile filtered solution containing PBS, 1M urea and 25mM Arginine.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
PfHSP70Description:
Plasmodium Falciparum HSP70 Recombinant
Product # :
MAL-001Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant Plasmodium falciparum contains the Plasmodium falciparum HSP70 protein epitopes 33-114 amino acids.
Formulation
150mM Imidazole, pH 8.0, 150mM NaCl, 150mM Sodium Phosphate and 50% glycerol.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
More Info
-
Introduction
Plasmodium falciparum heat shock proteins (PfHSPs) contribute to immunopathological alterations in infected hosts PfHSP70s may have a significant function during parasite adaptation in its environments. They have also been a focus of considerable attention due to their immunodominant antigenic nature and their properties as mediators of protective immunity.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
PfHSP70 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Use as an antigen in ELISA and Western Blots.
-
Purification Method
Purified by proprietary chromatographic technique
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
SARS Nucleocapsid PolyclonalDescription:
SARS-Nucleocapsid protein, Polyclonal Antibody
Product # :
ANT-180Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS and 0.02% sodium azide.
More Info
-
Introduction
SARS Coronavirus is an enveloped virus containing three outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein plays an important role in virus infection cycle and is the primary target of neutralizing antibodies.
It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics. -
Stability
Store at 4°C, stable for 2 weeks. For long-term storage, store at -20°C.
-
Immunogen
The antibody was developed by immunizing rabbits with synthetic peptides corresponding to amino a.a. 399-411 of putative SARS nucleocapsid (Genbank accession no. YP_009724397.2).
-
Applications
Western Blot 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:500
-
Isotype
Rabbit IgG.
-
Type
Polyclonal Rabbit Antibody.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
RSV Paired AntibodyDescription:
Mouse Anti Human Respiratory Syncytial Virus
Product # :
ANT-653Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
RSV gold conjugation antibody and RSV capture antibody are used to develop rapid test for RSV rapid test. Please note that when ordering for example: 100µg antibody we ship 50µg from each of the antibodies (100µg in total).
Formulation
* RSV gold conjugation antibody in PBS, PH 7.4.
* RSV capture antibody in PBS, PH 7.4.Purity
Greater than 95%.
More Info
-
Physical Appearance
2 vials of sterile Filtered clear colorless solution.
-
Stability
RSV Paired Antibody although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Lateral flow rapid test.
-
Type
Mouse antibody Monoclonal.
-
Purification Method
Purified monoclonal IgG2a by protein A chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 gp41, HRPDescription:
HIV-1 gp41 Recombinant, HRP labeled
Product # :
HIV-118Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HIV-1 gp41 HRP labeledis a non-glycosylated polypeptide chain, containing 288 amino acids (466-753 a.a.) and having a Mw of 32kDa. HIV1 gp41 HRP labeled is fused to an 114kDa beta-galactosidase tag at N-terminus having a total Mw of 146kDa.
Source
Escherichia Coli.
Formulation
(1mg/ml) 8M urea, 20mM Tris-HCl pH-8.0 and 10mM b-mercaptoethanol.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
-
Physical Appearance
Sterile filtered colorless clear solution.
-
Stability
HIV-1 horseradish peroxidase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Specificity
Reacts strongly with human HIV positive serum.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
TBEV CoreDescription:
Tick-Borne Encephalitis Virus Core Protein Recombinant
Product # :
TBE-285Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the Tick-borne Encephalitis Virus core protein epitopes.
Source
Escherichia Coli.
Formulation
20mM MES pH 6.5, 8M urea, 200mM NaCl & 0.05% Tween-20.
Purity
Encephalitis protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
TBE is caused by tick-borne encephalitis virus (TBEV), a member of the family Flaviviridae.
A closely related virus in Far Eastern Eurasia, Russian spring-summer encephalitis virus (RSSEV).
The family Flaviviridae includes other tick-borne viruses are closely related to TBEV and RSSEV, such as Omsk hemorrhagic fever virus & Kyasanur Forest virus.
Louping ill virus is also a member of this family. -
Stability
Encephalitis protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Encephalitis antigen is suitable for ELISA and Western blots, excellent antigen for detection of Tick-borne encephalitis virus with minimal specificity problems.
-
Specificity
Immunoreactive with sera of encephalitis virus infected individuals.
-
Purification Method
Encephalitis protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HSV-2 gBDescription:
Herpes Simplex Virus-2 gB Recombinant
Product # :
HSV-226Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35).
Source
Escherichia Coli.
Formulation
10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Purity
Protein is >90% pure as determined by SDS PAGE.
More Info
-
Introduction
Entry of HSV into the host cell involves interactions of several viral glycoproteins with cell surface receptors. The virus particle is covered by an envelope which, when bound to specific receptors on the cell surface, will fuse with the cell membrane and create an opening, or pore, through which the virus enters the host cell. The sequential stages of HSV entry are analagous to those of other viruses. At first, complementary receptors on the virus and cell surface bring the two membranes into proximity. In an intermediate state, the two membranes begin to merge, forming a hemifusion state. Finally, a stable entry pore is formed through which the viral envelope contents are introduced to the host cell.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Amino Acid Sequence
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGT
TVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGF
YARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH. -
Applications
ELISA, WB, Flow-Through.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Malaria Pv. MSP1Description:
Malaria Vivax MSP1 Recombinant
Product # :
MAL-003Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Merozoite surface antigen is a protein located on the outside of the merozoite, playing an imperative role in immune reaction. About 45% cases of malaria are infected by Plasmodium vivax (Pv). Pv. MSP1 has to be used with Plasmodium falciparum (Pf) together for ELISA and rapid diagnostic test, Plasmodium falciparum and vivax infection takes about 95% of Plasmodium caused infection.Recombinant Malaria Vivax MSP1 produced in E.coli and fused to a His tag was purified by proprietary chromatographic technique.
Formulation
Sterile Filtered solution containing Phosphate buffered saline and 25mM K2CO3.
Purity
Protein is >95% pure as determined by SDS-PAGE.
More Info
-
Introduction
Plasmodium falciparum is a protozoan parasite, one of the species of Plasmodium that cause malaria. Malaria parasites are members of the Apicomplexa. Apicomplexa are characterized by a set of organelles found in some stages of the parasite's life cycle. These organelles, collectively known as apical organelles because of their localization at one end of the parasite, are involved in interactions between the parasite and host. In particular, the apical organelles have been implicated in the process of host cell invasion. In the case of Plasmodium, three distinct invasive forms have been identified: sporozoite, merozoite, and ookinete.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Pv. MSP1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Rapid test and Immunoassay.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Influenza-A Solomon IslandsDescription:
H1N1 Influenza-A Virus Solomon Islands/03/06
Product # :
IHA-022Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza A virus, strain A/Solomon Islands/03/06. The Influenza Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The H1N1 A/Solomon Islands/03/06 solution contains 0.1M NaCl, 10mM Tris-HCl, 1mM EDTA pH-8 (STE), 0.1% sodium azide (NaN3) and 0.005% thimerosal.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H1N1 is a subtype specie of Influenza A virus. H1N1 Influenza Virus has mutated into various strains such as the Spanish Flu strain, mild human flu strains, endemic pig strains, and various strains found in birds.
The Influenza A Virus is a globular particle about 100nm in diameter, sheathed in a lipid bilayer derived from the plasma membrane of its host. Studded in the lipid bilayer are two integral membrane proteins some 500 molecules of hemagglutinin ("H") and some 100 molecules of neuraminidase ("N"). Within the lipid bilayer are 3000 molecules of matrix protein and 8 pieces of RNA. Each of the 8 RNA molecules is associated with many copies of a nucleoprotein, several molecules of the three subunits of its RNA polymerase some "non-structural" protein molecules of uncertain function. -
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
A/Solomon Islands/03/06 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatment.This product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Tested with anti-influenza A monoclonal antibodies in ELISA.Serological studies of influenza A virus, immunogen for antibody production.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-2 gp36, 17kDaDescription:
HIV-2 gp36 Recombinant
Product # :
HIV-005Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant HIV-2 gp36 produced in E.coli is a non-glycosylated polypeptide chain contains HIV2 subtype A gp 36 sequence and purified by proprietary chromatographic technique.
Source
Escherichia Coli.
Formulation
HIV-2 gp36 contains PBS, 25mM K2CO3 and 0.025% NaN3.
Purity
Protein is >90% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HIV-1 and HIV-2 appear to package their RNA differently. HIV-1 binds to any appropriate RNA whereas HIV-2 preferentially binds to mRNA which creates the Gag protein itself. This means that HIV-1 is better able to mutate. HIV-2 is transmitted in the same ways as HIV-1: Through exposure to bodily fluids such as blood, semen, tears and vaginal fluids. Immunodeficiency develops more slowly with HIV-2.
HIV-2 is less infectious in the early stages of the virus than with HIV-1.
The infectiousness of HIV-2 increases as the virus progresses.
Major differences include reduced pathogenicity of HIV-2 relative to HIV-1, enhanced immune control of HIV-2 infection and often some degree of CD4-independence. Despite considerable sequence and phenotypic differences between HIV-1 and 2 envelopes, structurally they are quite similar. Both membrane-anchored proteins eventually form the 6-helix bundles from the N-terminal and C-terminal regions of the ectodomain, which is common to many viral and cellular fusion proteins and which seems to drive fusion.
HIV-1 gp41 helical regions can form more stable 6-helix bundles than HIV-2 gp41 helical regions however HIV-2 fusion occurs at a lower threshold temperature (25°C), does not require Ca2+ in the medium, is insensitive to treatment of target cells with cytochalasin B, and is not affected by target membrane glycosphingolipid composition. -
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Applications
ELISA, lateral flow assay.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Borrelia Spielmanii DbpADescription:
Borrelia Spielmanii Decorin Binding Protein A Recombinant
Product # :
BOR-026Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Borrelia Spielmanii Decorin Binding Protein A produced in E.coli is a non-glycosylated, polypeptide chain having a calculated molecular mass of 17kDa. Borrelia Spielmanii DbpA is expressed with a -10x His tag at N-terminus and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Borrelia Spielmanii DbpA is supplied in 20mM HEPES buffer pH-7.6, 250mM NaCl and 20% glycerol.
Purity
Greater than 80.0% as determined by SDS-PAGE.
More Info
-
Introduction
Borrelia is a part of the genus of bacteria of the spirochete phylum. Borrelia causes borreliosis, which is a zoonotic, vector-borne disease transmitted mostly by ticks and some by lice, depending on the species. Of the 36 known species of Borrelia, 12 are distinguished to cause Lyme disease or borreliosis and are transmitted by ticks. The Gram-negative bacterium Borreliella spielmanii is one of the pathogens of the Borreliella burgdorferi sensu lato complex causing Lyme disease. DbpA, also known as p17 or Osp17, is a heterogeneous protein among the human pathogenic B. burgdorferi sensu lato species.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
-
Immunological Functions
1. Binds IgG- and IgM-type human antibodies.2. Immunodot test with Lyme disease positive/negative plasma.
-
Applications
Western blot with Lyme positive plasma.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HAVCR2 HumanDescription:
Hepatitis A Virus Cellular Receptor 2 Human Recombinant
Hepatitis A virus cellular receptor 2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3, TIMD-3, T-cell membrane protein 3, TIM-3, HAVCR2, TIM3, TIMD3, TIM3, KIM-3.
Product # :
HAV-224Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Human HAVCR2 produced in E. coli is a single polypeptide chain containing 206 amino acids (aa 22-202) and having a molecular mass of 22.7kDa.HAVCR2 is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The HAVCR2 solution (1mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.4M urea and 10% glycerol.
Purity
Greater than 90% as determined by SDS-PAGE.
More Info
-
Introduction
Hepatitis A Virus Cellular Receptor 2 (HAVCR2) is a member of the immunoglobulin superfamily. HACVR2 controls macrophage activation. HACVR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and stimulates immunological tolerance.
-
Synonyms
Hepatitis A virus cellular receptor 2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3, TIMD-3, T-cell membrane protein 3, TIM-3, HAVCR2, TIM3, TIMD3, TIM3, KIM-3.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MGSHMSEVEY RAEVGQNAYL PCFYTPAAPG NLVPVCWGKG ACPVFECGNV VLRTDERDVN YWTSRYWLNG DFRKGDVSLT IENVTLADSG IYCCRIQIPG IMNDEKFNLK LVIKPAKVTP APTLQRDFTA AFPRMLTTRG HGPAETQTLG SLPDINLTQI STLANELRDS RLANDLRDSG ATIRIG.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 gp41/120Description:
HIV-1 gp41-gp120 Mosaic Recombinant
Product # :
HIV-158Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HIV-1 gp41-gp120 is a non-glycosylated polypeptide chain fused to 6xHis Tag.
Source
Escherichia Coli.
Formulation
150mM NaCl, 25mM sodium phosphate pH-8, 50% glycerol and 150mM imidazole.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Human immunodeficiency virus (HIV) is a retrovirus that can lead to a condition in which the immune system begins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the human immune system such as helper T cells (specifically CD4+ T cells), macrophages and dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosis in infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytes that recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunity is lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are charact
-
Physical Appearance
Sterile filtered colorless clear solution.
-
Stability
HIV-1 gp41/120 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Specificity
Immunoreactive with all sera of HIV-I infected individuals.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.