Search results

What is the molecular weight/Mw of IL1RA MOUSE Protein?
IL1RA MOUSE Protein has a total Mw of 17.4kDa.

What is the source or expression system of IL1RA MOUSE Protein?
Escherichia Coli.

What is the Purity of IL1RA MOUSE Protein?
IL1RA MOUSE Protein is >98% pure as determined by SDS-PAGE.

What is the Biological Activity of IL1RA MOUSE Protein?
The mouse IL-1Ra is capable of inhibiting IL-1-alpha activity in helper T cell line D10.G4.1.

What is the amino acid sequence of IL1RA MOUSE Protein?
The sequence of the first six N-terminal amino acids was determined and was found to be Ala-Cys-Arg-Pro-Ser-Gly.

What applications can IL1RA MOUSE Protein be used in?
IL1RA MOUSE Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for IL1RA MOUSE Protein?
The endotoxin level is minimal, IL1RA MOUSE Protein was purified using conventional chromatography techniques.

Who supplies recombinant IL1RA MOUSE that is in stock and available to order?
ProSpec has the protein in stock and available for immediate delivery.

Where can I order bulk mg quantities of IL1RA MOUSE?
ProSpec supplies bulk mg quantities at affordable prices that meets research and academic budgets.

IL-22 is a part of the IL-10 family of regulatory cytokines and produced by a few populations of immune cells at a site of inflammation. Members of this family share partial homology in their amino acid sequences, but varies in their biological functions. IL-22 effects on non-hematopoietic cells. IL-22 responsible for wound healing and takes part in protection against microbs. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the pancreas and liver.

B-cell Activating Factor Receptor Human Recombinant: Unlocking the Potential of a Key Immunomodulatory Target

Abstract:

B-cell Activating Factor Receptor (BAFF-R) human recombinant is a critical component of the B-cell immune response, playing a pivotal role in B-cell survival, maturation, and antibody production. This research paper provides a comprehensive analysis of BAFF-R, including its characteristics, signaling pathways, and potential therapeutic applications. Furthermore, innovative methodologies for the production and optimization of BAFF-R human recombinant are proposed, shedding light on its future implications in the field of immunotherapy.

Introduction:

The immune system relies on the precise regulation of B-cell functions, with BAFF-R serving as a key modulator of B-cell development and activation. This paper explores the unique features of BAFF-R and presents novel approaches for its production and optimization, aiming to uncover its therapeutic potential.

Characteristics and Signaling Pathways:

BAFF-R is a type III transmembrane protein expressed primarily on B-cells. It belongs to the tumor necrosis factor receptor superfamily and binds specifically to B-cell activating factor (BAFF). Engagement of BAFF-R by BAFF initiates intracellular signaling cascades, including the activation of nuclear factor-kappa B (NF-κB) and mitogen-activated protein kinase (MAPK) pathways, promoting B-cell survival, proliferation, and differentiation.

Production of BAFF-R Human Recombinant:

Efficient production methodologies are crucial for the therapeutic application of BAFF-R human recombinant. Various expression systems, such as mammalian cell-based platforms, have been explored to ensure proper folding and post-translational modifications of the protein. Optimization strategies, including codon optimization and vector design, have been employed to enhance production efficiency. Purification techniques, such as affinity chromatography and size exclusion chromatography, have been optimized to isolate high-quality BAFF-R recombinant.

Potential Therapeutic Applications:

BAFF-R human recombinant holds great promise in the field of immunotherapy. Dysregulation of the BAFF/BAFF-R signaling axis has been implicated in autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis. Thus, modulating BAFF-R activity using BAFF-R human recombinant may provide a targeted therapeutic approach for these conditions. Additionally, BAFF-R represents a potential target for B-cell malignancies, and BAFF-R human recombinant may serve as an adjuvant therapy in combination with existing treatments.

Conclusion:

BAFF-R human recombinant represents a crucial immunomodulatory target with diverse therapeutic applications in immunotherapy. Optimizing production methodologies and further understanding its signaling pathways will enhance its clinical utility. With its potential implications in autoimmune diseases and B-cell malignancies, BAFF-R human recombinant holds immense promise as an innovative therapeutic tool for immune-related disorders.

What is the molecular weight/Mw of BAFF R Protein?
BAFF R Protein has a total Mw of 7.7kDa.

What is the source or expression system of BAFF R Protein?
Escherichia Coli.

What is the Purity of BAFF R Protein?
BAFF R Protein is >95% pure as determined by SDS-PAGE.

What is the Biological Activity of BAFF R Protein?
Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF.

What is the amino acid sequence of BAFF R Protein?
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG
ASSPAPRTALQPQESVGAGAGEAALPLPG.

What applications can BAFF R Protein be used in?
BAFF R Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for BAFF R Protein?
The endotoxin level is minimal, BAFF R Protein was purified using conventional chromatography techniques.

Title: GM-CSF Receptor Beta Human Recombinant: A Key Receptor in Immunological Research

Abstract:

Granulocyte-macrophage colony-stimulating factor receptor beta (GM-CSF Rβ) is a crucial receptor involved in immune cell development and function. This research paper provides a comprehensive analysis of human recombinant GM-CSF Rβ, focusing on its production, characterization, and applications in immunological research. The paper discusses the significance of GM-CSF Rβ in immune cell signaling and its role in various immune-related disorders. Furthermore, it elucidates the potential therapeutic implications of recombinant GM-CSF Rβ in immunotherapy and highlights ongoing research in the field. The information presented in this paper aims to enhance the understanding of human recombinant GM-CSF Rβ and its utility as a research tool in immunological studies.

Introduction:

Granulocyte-macrophage colony-stimulating factor receptor beta (GM-CSF Rβ) is a high-affinity receptor that binds to granulocyte-macrophage colony-stimulating factor (GM-CSF). It plays a critical role in immune cell development, differentiation, and activation. Human recombinant GM-CSF Rβ, produced through genetic engineering techniques, enables researchers to investigate its biological functions and therapeutic potential.

Production and Characterization:

Recombinant GM-CSF Rβ is typically produced using expression systems such as mammalian cells or bacteria. The protein is then purified and characterized to ensure its structural integrity and functional activity. Quality control measures are implemented to confirm the specificity and binding affinity of the recombinant receptor.

Immunological Significance:

GM-CSF Rβ is expressed on various immune cells, including myeloid cells, dendritic cells, and macrophages. It plays a crucial role in cell signaling pathways, promoting cell proliferation, survival, and activation. The dysregulation of GM-CSF Rβ signaling has been implicated in autoimmune diseases, inflammatory disorders, and hematological malignancies. Recombinant GM-CSF Rβ provides a valuable tool for investigating these immune-related processes and deciphering the underlying mechanisms.

Therapeutic Implications:

The dysregulation of GM-CSF Rβ signaling in immune-related disorders has prompted the exploration of recombinant GM-CSF Rβ as a potential therapeutic target. Targeted therapies, such as monoclonal antibodies and small-molecule inhibitors, are being developed to modulate GM-CSF Rβ signaling and restore immune homeostasis. Ongoing research focuses on optimizing these therapeutic approaches and identifying novel treatment strategies.

Conclusion:

Human recombinant GM-CSF Rβ is a critical research tool in the field of immunology. Its production, characterization, and applications in immune cell signaling contribute to our understanding of immune responses and the development of novel therapeutics. Continued research and advancements in GM-CSF Rβ-based immunotherapy hold promise for improving treatment outcomes in various immune-related disorders.

What is the molecular weight/Mw of CD131 Protein?
CD131 Protein has a total Mw of 49.7kDa.

What is the source or expression system of CD131 Protein?
Sf9, Baculovirus cells.
What is the Purity of CD131 Protein?
CD131 Protein is >95% pure as determined by SDS-PAGE.

What is the Biological Activity of CD131 Protein?
The biological functionality of CD131 Protein will be determined in the future.

What is the amino acid sequence of CD131 Protein?
WERSLAGAEE TIPLQTLRCY NDYTSHITCR WADTQDAQRL VNVTLIRRVN EDLLEPVSCD LSDDMPWSAC PHPRCVPRRC VIPCQSFVVT DVDYFSFQPD RPLGTRLTVT LTQHVQPPEP RDLQISTDQD HFLLTWSVAL GSPQSHWLSP GDLEFEVVYK RLQDSWEDAA ILLSNTSQAT LGPEHLMPSS TYVARVRTRL APGSRLSGRP SKWSPEVCWD SQPGDEAQPQ NLECFFDGAA VLSCSWEVRK EVASSVSFGL FYKPSPDAGE EECSPVLREG LGSLHTRHHC QIPVPDPATH GQYIVSVQPR RAEKHIKSSV NIQMAPPSLN VTKDGDSYSL RWETMKMRYE HIDHTFEIQY RKDTATWKDS KTETLQNAHS MALPALEPST RYWARVRVRT SRTGYNGIWS EWSEARSWDT ESVLPMWLEH HHHHH.

What applications can CD131 Protein be used in?
CD131 Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for CD131 Protein?
The endotoxin level is minimal, CD131 Protein was purified using conventional chromatography techniques.

What is the molecular weight/Mw of IRF3 HUMAN Protein?
IRF3 HUMAN Protein has a total Mw of 13kDa.

What is the source or expression system of IRF3 HUMAN Protein?
Escherichia Coli.

What is the Purity of IRF3 HUMAN Protein?
IRF3 HUMAN Protein is >95% pure as determined by SDS-PAGE.

What is the Biological Activity of IRF3 HUMAN Protein?
The biological functionality of IRF3 HUMAN Protein will be determined in the future.

What is the amino acid sequence of IRF3 HUMAN Protein?
MGTPKPRILP WLVSQLDLGQ LEGVAWVNKS RTRFRIPWKH GLRQDAQQED FGIFQAWAEA TGAYVPGRDK PDLPTWKRNF RSALNRKEGL RLAEDRSKDP HDPHKIYEFV NS.

What applications can IRF3 HUMAN Protein be used in?
IRF3 HUMAN Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for IRF3 HUMAN Protein?
The endotoxin level is minimal, IRF3 HUMAN Protein was purified using conventional chromatography techniques.

What is the molecular weight/Mw of IL3 MOUSE, SF9 Protein?
IL3 MOUSE, SF9 Protein has a total Mw of 16.7kDa.

What is the source or expression system of IL3 MOUSE, SF9 Protein?
Sf9, Baculovirus cells.

What is the Purity of IL3 MOUSE, SF9 Protein?
IL3 MOUSE, SF9 Protein is >90% pure as determined by SDS-PAGE.

What is the Biological Activity of IL3 MOUSE, SF9 Protein?
The ED50 is Measured in a cell proliferation assay using TF-1 human erythroleukemic and is ≤ 0.1 ng/ml.

What is the amino acid sequence of IL3 MOUSE, SF9 Protein?
ASISGRDTHR LTRTLNCSSI VKEIIGKLPE PELKTDDEGP SLRNKSFRRV NLSKFVESQG EVDPEDRYVI KSNLQKLNCC LPTSANDSAL PGVFIRDLDD FRKKLRFYMV HLNDLETVLT SRPPQPASGS VSPNRGTVEC LEHHHHHH.

What applications can IL3 MOUSE, SF9 Protein be used in?
IL3 MOUSE, SF9 Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for IL3 MOUSE, SF9 Protein?
The endotoxin level is minimal, IL3 MOUSE, SF9 Protein was purified using conventional chromatography techniques.

Who supplies recombinant IL3 MOUSE, SF9 that is in stock and available to order?
ProSpec has the protein in stock and available for immediate delivery.

Where can I order bulk mg quantities of IL3 MOUSE, SF9?
ProSpec supplies bulk mg quantities at affordable prices that meets research and academic budgets.

IL-22 belongs to the IL-10 family of regulatory cytokines and produced by several populations of immune cells at a site of inflammation. Members of this family share partial homology in their amino acid sequences, but varies in their biological functions. IL-22 takes effect on non-hematopoietic cells. IL-22 takes pat in wound healing and in protection against microbs.Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the pancreas and liver.

B-cell Activating Factor (BAFF) and its corresponding receptor, BAFF-R, are integral components of the immune system, orchestrating crucial processes in B-cell survival, maturation, and differentiation. As we delve into the intricate world of immunology, the study of BAFF and its receptor has unveiled essential pathways that govern the immune responses in health and disease. This research investigates the multifaceted role of BAFF Receptor Protein, shedding light on its structural complexities, signaling mechanisms, and its pivotal contributions to immune regulation. By exploring the interactions between BAFF and its receptor, scientists aim to decipher the delicate balance that underlies immune homeostasis and explore potential therapeutic avenues.

Structural Architecture of BAFF Receptor Protein:

BAFF Receptor, a transmembrane protein predominantly expressed on B cells, belongs to the tumor necrosis factor receptor (TNFR) superfamily. Its intricate structure involves various domains, each playing a unique role in ligand binding, receptor activation, and downstream signaling. Understanding the structural intricacies of BAFF Receptor is paramount to unraveling the molecular events that govern B-cell fate decisions and immune responses.

Physiological Significance in B-Cell Biology:

BAFF Receptor, upon binding with its ligand BAFF, initiates a cascade of events critical for B-cell survival and function. This interaction promotes B-cell maturation, prevents premature apoptosis, and influences the formation of immune synapses. Additionally, BAFF Receptor signaling is tightly regulated to prevent excessive B-cell activation, ensuring immune tolerance and preventing autoimmune responses. Disruptions in these pathways can lead to autoimmune disorders, underscoring the crucial role of BAFF Receptor in maintaining immune equilibrium.

Regulation of Immune Responses:

BAFF Receptor signaling not only affects B-cell development but also has broader implications for immune responses. By modulating antibody production, B-cell activation, and immune memory, BAFF Receptor plays a vital role in shaping adaptive immunity. Its dysregulation has been implicated in various autoimmune conditions, making it an attractive target for therapeutic interventions aimed at restoring immune balance.

BAFF Receptor as a Therapeutic Target:

The intricate involvement of BAFF Receptor in autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus, has positioned it as a promising therapeutic target. Researchers are exploring monoclonal antibodies and other targeted therapies that aim to modulate BAFF Receptor signaling, providing a new frontier in autoimmune disease management. Additionally, understanding the BAFF-BAFF Receptor axis offers potential insights into the development of vaccines and immunotherapies, fostering innovative approaches in the fight against infectious diseases and malignancies.

BAFF Receptor Protein, as a key player in immune regulation, embodies the complexities of immunology. Its interactions with BAFF orchestrate fundamental processes in B-cell biology and adaptive immunity. As scientists unravel the intricate signaling pathways and structural nuances of BAFF Receptor, they pave the way for novel therapeutic strategies and innovative treatments for autoimmune disorders and beyond. This research not only deepens our understanding of immune regulation but also holds the promise of transformative advancements in immunotherapy, ultimately shaping the future of immune-related healthcare.

What is the molecular weight/Mw of BAFF-R Protein?
BAFF-R Protein has a total Mw of 34.4kDa.

What is the source or expression system of BAFF-R Protein?
HEK293 Cells.

What is the Purity of BAFF-R Protein?
BAFF-R Protein is >95% pure as determined by SDS-PAGE.

What is the Biological Activity of BAFF-R Protein?
The ED50 is ≤0.7 ug/ml, measured by its ability in a functional ELISA with BAFF Human.

What is the amino acid sequence of BAFF-R Protein?
DGSMRRGPRS LRGRDAPAPT PCVPAECFDL LVRHCVACGL LRTPRPKPAG ASSPAPRTAL QPQESVGAGA GEAALPLPGL LLEPKSCDKT HTCPPCPAPE LLGGPSVFLF PPKPKDTLMI SRTPEVTCVV VDVSHEDPEV KFNWYVDGVE VHNAKTKPRE EQYNSTYRVV SVLTVLHQDW LNGKEYKCKV SNKALPAPIE KTISKAKGQP REPQVYTLPP SRDELTKNQV SLTCLVKGFY PSDIAVEWES NGQPENNYKT TPPVLDSDGS FFLYSKLTVD KSRWQQGNVF SCSVMHEALH NHYTQKSLSL SPGK.

What applications can BAFF-R Protein be used in?
BAFF-R Protein can probably be used in western blot, ELISA and Lateral Flow.

What is the endotoxin level for BAFF-R Protein?
The endotoxin level is minimal, BAFF-R Protein was purified using conventional chromatography techniques.