Search results
1000 results found for “Myxovirus”
Name
Description
Product #
Price
Quantity
Shipping Method
- View Data Sheet
Name :
IFNG Human, HisDescription:
Interferon-Gamma Human Recombinant, His Tag
Immune Interferon, type II interferon, T cell interferon, MAF, IFNG, IFG, IFI, IFN-gamma.
Product # :
CYT-478Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
- SDS-PAGE
Description
IFN-Gamma Human Recombinant produced in E.Coli is a single, glycosylated polypeptide chain containing 159 amino acids (24-161 a.a) without cysteine residues and having a molecular mass of 18.5kDa (confirmed by MALDI-TOF). IFN-Gamma is fused to a 21 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Interferon-g is supplied in phosphate-buffered Saline (pH 7.4).
Purity
Greater than 90.0% as determined by analysis by SDS-PAGE.
SDS-PAGE
More Info
-
Introduction
IFN-gamma produced by lymphocytes activated by specific antigens or mitogens.
IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions, it is a potent activator of macrophages, and has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. -
Synonyms
Immune Interferon, type II interferon, T cell interferon, MAF, IFNG, IFG, IFI, IFN-gamma.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MQDPYVKEAE NLKKYFNAGH SDVADNGTLF LGILKNWKEE SDRKIMQSQI VSFYFKLFKN FKDDQSIQKS VETIKEDMNV KFFNSNKKKR DDFEKLTNYS VTDLNVQRKA IHELIQVMAE LSPAAKTGKR KRSQMLFRG.
-
Background
What is the molecular weight/Mw of IFNG HUMAN, HIS Protein?
IFNG HUMAN, HIS Protein has a total Mw of 18.5kDa.
What is the source or expression system of IFNG HUMAN, HIS Protein?
Escherichia Coli.
What is the Purity of IFNG HUMAN, HIS Protein?
IFNG HUMAN, HIS Protein is >90% pure as determined by SDS-PAGE.
What is the Biological Activity of IFNG HUMAN, HIS Protein?
The biological functionality of IFNG HUMAN, HIS Protein will be determined in the future.
What is the amino acid sequence of IFNG HUMAN, HIS Protein?
MGSSHHHHHH SSGLVPRGSH MQDPYVKEAE NLKKYFNAGH SDVADNGTLF LGILKNWKEE SDRKIMQSQI VSFYFKLFKN FKDDQSIQKS VETIKEDMNV KFFNSNKKKR DDFEKLTNYS VTDLNVQRKA IHELIQVMAE LSPAAKTGKR KRSQMLFRG.
What applications can IFNG HUMAN, HIS Protein be used in?
IFNG HUMAN, HIS Protein can probably be used in western blot, ELISA and Lateral Flow.
What is the endotoxin level for IFNG HUMAN, HIS Protein?
The endotoxin level is minimal, IFNG HUMAN, HIS Protein was purified using conventional chromatography techniques.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
SURA E.ColiDescription:
Chaperone SURA E.Coli Recombinant
Rotamase surA, Survival protein A.
Product # :
ENZ-257Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- biological activity
- More Info
Description
SURA E.Coli Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 429 amino acids (21-428 a.a.) and having a molecular weight of 47.3kDa. The SURA is fused to 20 a.a His-Tag at N-terminus and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The SURA 1mg/ml protein solution contains 20mM Tris-HCl, pH-8, and 10% glycerol.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Biological Activity
Specific activity is > 450 nmoles/min/ug, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25C in Tris-Hcl pH8.0 using chymotrypsin.
More Info
-
Introduction
SURA is a PPIase enzyme and chaperone of Escherichia coli and other Gram-negative bacteria. SURA is a key player in the biogenesis of beta-barrel outer membrane proteins and is involved in cell envelope homeostasis and cell envelope functions. SURA is necessary for the survival of E.coli in stationary phase and needed for pilus biogenesis.
-
Synonyms
Rotamase surA, Survival protein A.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MAPQVVDKVA AVVNNGVVLE SDVDGLMQSV KLNAAQARQQ LPDDATLRHQ IMERLIMDQI ILQMGQKMGV KISDEQLDQA IANIAKQNNM TLDQMRSRLA YDGLNYNTYR NQIRKEMIIS EVRNNEVRRR ITILPQEVES LAQQVGNQND ASTELNLSHI LIPLPENPTS DQVNEAESQA RAIVDQARNG ADFGKLAIAH SADQQALNGG QMGWGRIQEL PGIFAQALST AKKGDIVGPI RSGVGFHILK VNDLRGESKN ISVTEVHARH ILLKPSPIMT DEQARVKLEQ IAADIKSGKT TFAAAAKEFS QDPGSANQGG DLGWATPDIF DPAFRDALTR LNKGQMSAPV HSSFGWHLIE LLDTRNVDKT DAAQKDRAYR MLMNRKFSEE AASWMQEQRA SAYVKILSN.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
IRF3 HumanDescription:
IFN Regulatory Factor-3 Human Recombinant
IRF-3, IRF3, IFN Regulatory Factor 3.
Product # :
CYT-292Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
IRF-3 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids (1-112) and having a molecular mass of 13 kDa.The IRF3 is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
1mg/ml in phosphate-buffered saline (PBS), pH 7.4.
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.More Info
-
Introduction
Members of the IFN regulatory factor (IRF) family regulate gene expression critical to immune response, hemopoiesis, and proliferation. IRF-3 is a member of the IRF family, and is distinct from other family members. Its transcriptional activity is regulated solely by posttranslational modifications. It plays a crucial role in activation of innate immunity and inflammation in response to viral infection. IRF-3 mediates IFN-stimulated response element (isre) promoter activation. Functions as a molecular switch for antiviral activity. Dsrna generated during the course of an viral infection leads to IRF3 phosphorylation on the c-terminal serine/threonine cluster. This induces a conformational change, leading to its dimerization, nuclear localization and association with creb binding protein (crebbp) to form dsrna-activated factor 1 (draf1), a complex which activates the transcription of genes under the control of isre. The complex binds to the ie and prdiii regions on the ifn-alpha and ifn-beta promoters respectively. IRF-3 does not have any transcription activation domains.
-
Synonyms
IRF-3, IRF3, IFN Regulatory Factor 3.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
Liquid IRF3 although stable at 10°C for 1 week, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
-
Amino Acid Sequence
MGTPKPRILP WLVSQLDLGQ LEGVAWVNKS RTRFRIPWKH GLRQDAQQED FGIFQAWAEA TGAYVPGRDK PDLPTWKRNF RSALNRKEGL RLAEDRSKDP HDPHKIYEFV NS.
-
Background
What is the molecular weight/Mw of IRF3 HUMAN Protein?
IRF3 HUMAN Protein has a total Mw of 13kDa.
What is the source or expression system of IRF3 HUMAN Protein?
Escherichia Coli.
What is the Purity of IRF3 HUMAN Protein?
IRF3 HUMAN Protein is >95% pure as determined by SDS-PAGE.
What is the Biological Activity of IRF3 HUMAN Protein?
The biological functionality of IRF3 HUMAN Protein will be determined in the future.
What is the amino acid sequence of IRF3 HUMAN Protein?
MGTPKPRILP WLVSQLDLGQ LEGVAWVNKS RTRFRIPWKH GLRQDAQQED FGIFQAWAEA TGAYVPGRDK PDLPTWKRNF RSALNRKEGL RLAEDRSKDP HDPHKIYEFV NS.
What applications can IRF3 HUMAN Protein be used in?
IRF3 HUMAN Protein can probably be used in western blot, ELISA and Lateral Flow.
What is the endotoxin level for IRF3 HUMAN Protein?
The endotoxin level is minimal, IRF3 HUMAN Protein was purified using conventional chromatography techniques.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HPRT PAT1D9AT AntibodyDescription:
Hypoxanthine-Guanine Phosphoribosyltransferase Clone PAT1D9AT, Mouse Anti Human
Hypoxanthine-Guanine Phosphoribosyltransferase , EC 2.4.2.8, HGPRT, HGPRTase, HPRT, HPRT1.
Product # :
ANT-727Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
HPRT1 has a main part in the generation of purine nucleotides through the purine salvage pathway. HPRT1 primarily functions to salvage purines from degraded DNA to renewed purine synthesis. Therefore, it performs as a catalyst in the reaction between guanine and phosphoribosyl pyrophosphate to form GMP.
-
Synonyms
Hypoxanthine-Guanine Phosphoribosyltransferase , EC 2.4.2.8, HGPRT, HGPRTase, HPRT, HPRT1.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human HPRT mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human HPRT amino acids 1-218 purified from E. coli.
-
Ig Subclass
Mouse IgG2b heavy chain and κ light chain.
-
Clone
PAT1D9AT.
-
Applications
HPRT antibody has been tested by ELISA, Western blot analysis, ICC/IF and Flow cytometry to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
HPRT antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
EGFR Antibody (PAT2H8AT)Description:
Epidermal Growth Factor Receptor Clone PAT2H8AT, Mouse Anti Human
ERBB, ERBB1, Epidermal growth factor receptor, HER1, PIG61, epidermal growth factor receptor, Urogastrone, Proto-oncogene c-ErbB-1, Oncogene ERBB, Cell proliferation inducing protein 61, Cell growth inhibiting protein 40, Avian erythroblastic leukemia viral (verbb) oncogene homolog.
Product # :
ANT-751Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
Epidermal growth factor receptor or EGFR or Erb-1 is a membranal protein that acts as a receptor for the extracellular EGF proteins family. This protein is a part of a family of receptors called ErbB family which are all tyrosine kinases receptors. Mutations in the gene of this receptors can cause cancer.
-
Synonyms
ERBB, ERBB1, Epidermal growth factor receptor, HER1, PIG61, epidermal growth factor receptor, Urogastrone, Proto-oncogene c-ErbB-1, Oncogene ERBB, Cell proliferation inducing protein 61, Cell growth inhibiting protein 40, Avian erythroblastic leukemia viral (verbb) oncogene homolog.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human EGFR mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human EGFR amino acids 424-605 purified from E. coli.
-
Ig Subclass
Mouse IgG2b heavy chain and κ light chain.
-
Clone
PAT2H8AT.
-
Applications
EGFR antibody has been tested by ELISA, Western blot analysis and ICC/IF to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
EGFR antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
GMNN AntibodyDescription:
Geminin, Mouse Anti Human
GMNN, Geminin, DNA Replication Inhibitor, Gem, RP3-369A17.3.
Product # :
ANT-319Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.
More Info
-
Introduction
Geminin is a 25 kDa nuclear protein, which inhibits DNA replication and is degraded during the mitotic phase of the cell cycle. Geminin controls replication by binding to the licensing factor Cdt1, and is involved in neural differentiation. In addition, Geminin directly interacts with Six3 and Hox homeodomain proteins during embryogenesis and inhibits their functions. Geminin can also promote DNA replication. Geminin has 2 roles in 2 different stages of the cell cycle: Geminin is a negative regulator of DNA replication during the “S phase” of the cell cycle. Inhibition of Geminin during the “S phase” (by RNAi) results in an additional round of replication of portions of the genome. During the “M phase” of the cell cycle (mitosis) Geminin stabilizes the replication factor Cdt1 promoting DNA replication during the next cell cycle. Moreover, inhibition of Geminin during mitosis (by RNAi) causes destabilization of Cdt1 protein and impairment of DNA replication during the next cell cycle. G
-
Synonyms
GMNN, Geminin, DNA Replication Inhibitor, Gem, RP3-369A17.3.
-
Immunogen
Anti-human Geminin mAb is derived from hybridization of mouse SP2/0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human Geminin amino acids 1-209 purified from E. coli.
-
Ig Subclass
Mouse IgG1 heavy chain and κ light chain.
-
Clone
P2H7AT.
-
Applications
Geminin antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:500 ~ 1,000. Recommended starting dilution is 1:500.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
Geminin antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
FLAG Antibody, IgG2bDescription:
FLAG Peptide Mouse Antibody, IgG2b
Product # :
ANT-222Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- description
- formulation
- More Info
Description
Monoclonal antibodies are produced by immunizing mouse with synthetic peptide (DYKDDDDK), coupled to KLH.
Formulation
1×PBS & 50% glycerol.
More Info
-
Introduction
A fusion tag called FLAG consists of eight amino acids (AspTyrLysAspAspAspAspLys) including an enterokinase-cleavage site. FLAG is specifically designed for immunoaffinity chromatography. It allows elution under non-denaturing conditions. Several antibodies against this peptide have been developed. One antibody denoted as M1 binds the peptide in the presence of bivalent metal cations preferably Ca(+). Elution is effected by chelating agents. Another strategy is competitive elution with excess of free Flag Peptide. The FLAG peptide purifies and detects recombinant fusion proteins. FLAG peptide is useful in Western blotting, immunocytochemistry, immunoprecipitation, flow cytometry, protein purification, and in the study of protein-protein interactions, cell ultrastructure, and protein localization. Flag peptide is a hydrophilic tag which significantly improves the detection and purification of recombinant fusion proteins.
-
Ig Subclass
Mouse IgG2b.
-
Clone
PFLAGSHG.
-
Applications
Western Blot, Immunoprecipitation.
-
Titer
Western Blotting: 0.5µg/ml.
-
Type
Mouse Antibody Monoclonal.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
SYCE3 HumanDescription:
Synaptonemal Complex Central Element Protein 3 Human Recombinant
Synaptonemal complex central element protein 3, chromosome 22 open reading frame 41, Testis highly expressed gene 2 protein, testis highly expressed protein 2, THEG2, C22orf41.
Product # :
PRO-1179Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
SYCE3 Human Recombinant produced in E. coli is a single polypeptide chain containing 108 amino acids (1-88) and having a molecular mass of 12.8 kDa.SYCE3 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Source
E.coli.
Formulation
The SYCE3 solution (0.5mg/1ml) contains 20mM Tris-HCl buffer (pH 8.0), 200mM NaCl, 2mM DTT and 20% glycerol.
Purity
Greater than 90% as determined by SDS-PAGE.
More Info
-
Introduction
Synaptonemal complex central element protein 3 (SYCE3) is key component of the transverse central element of synaptonemal complexes (SCS). The synaptonemal complex is a protein structure which forms between homologous chromosomes (2 pairs of sister chromatids) during meiosis and is assumed to mediate chromosome pairing, synapsis, and recombination (crossing-over). The SYCE3 protein is essential for chromosome loading of the central element-specific SCS proteins, as well as for initiating synapsis between homologous chromosomes. SYCE3 is also vital for fertility.
-
Synonyms
Synaptonemal complex central element protein 3, chromosome 22 open reading frame 41, Testis highly expressed gene 2 protein, testis highly expressed protein 2, THEG2, C22orf41.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MDDADPEERN YDNMLKMLSD LNKDLEKLLE EMEKISVQAT WMAYDMVVMR TNPTLAESMR RLEDAFVNCK EEMEKNWQEL LHETKQRL
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
TNIP1 HumanDescription:
TNFAIP3 Interacting Protein 1 Human Recombinant
TNFAIP3-interacting protein 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Naf1, Nip40-1, Virion-associated nuclear shuttling protein, VAN, hVAN, TNIP1, KIAA0113, NAF1, ABIN-1.
Product # :
PRO-005Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
TNIP1 Human Recombinant fused with a 20 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 458 amino acids (94-530 a.a.) and having a molecular mass of 51.8kDa. The TNIP1 is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The TNIP1 solution (0.25 mg/ml) contains 20mM Tris-HCl buffer (pH7.5), 20% glycerol, 5mM DTT and 200mM NaCl.
Purity
Greater than 75.0% as determined by SDS-PAGE.
More Info
-
Introduction
TNFAIP3-interacting protein 1 (TNIP1) interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with a RIP- or TRAF2-mediated transactivation signal. Furthermore, TNIP1 interacts with HIV-1 matrix protein and is packaged into virions and its overexpression can inhibit viral replication. TNIP1 can regulate matrix nuclear localization, both nuclear import of Preintegration complex (PIC) and export of GAG polyprotein and viral genomic RNA during virion production.
-
Synonyms
TNFAIP3-interacting protein 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Naf1, Nip40-1, Virion-associated nuclear shuttling protein, VAN, hVAN, TNIP1, KIAA0113, NAF1, ABIN-1.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MSNVTASPTA PACPSDKPAP VQKPPSSGTS SEFEVVTPEE QNSPESSSHA NAMALGPLPR EDGNLMLHLQ RLETTLSVCA EEPDHGQLFT HLGRMALEFN RLASKVHKNE QRTSILQTLC EQLRKENEAL KAKLDKGLEQ RDQAAERLRE ENLELKKLLM SNGNKEGASG RPGSPKMEGT GKKAVAGQQQ ASVTAGKVPE VVALGAAEKK VKMLEQQRSE LLEVNKQWDQ HFRSMKQQYE QKITELRQKL ADLQKQVTDL EAEREQKQRD FDRKLLLAKS KIEMEETDKE QLTAEAKELR QKVKYLQDQL SPLTRQREYQ EKEIQRLNKA LEEALSIQTP PSSPPTAFGS PEGAGALLRK QELVTQNELL KQQVKIFEED FQRERSDRER MNEEKEELKK QVEKLQAQVT LSNAQLKAFK DEEKAREALR QQKRKAKA.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
MECP2 HumanDescription:
Methyl CpG Binding Protein 2 Human Recombinant
Methyl CpG binding protein 2 (Rett syndrome), MeCp-2 protein, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTT, Mental retardation, X-linked 16, DKFZp686A24160.
Product # :
PRO-212Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
MECP2 Human Recombinant is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.
Source
Mammalian system, 293 cells.
Formulation
The MECP2 solution (0.45mg/ml) contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200µg/ml FLAG peptide.
Purity
Greater than 80% as determined by SDS-PAGE.
More Info
-
Introduction
MECP2 is the key modificator of eukaryotic genomes and has a crucial part in mammalian development.
Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 form a family of nuclear proteins linked by the existence in each of a methyl-CpG binding domain (MBD). Each one of these proteins, with the exception of MBD3, can bind specifically to methylated DNA. In addition, MECP2, MBD1 and MBD2 can inhibit transcription from methylated gene promoters. Unlike other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is expendable in stem cells, but is vital for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common reasons of mental retardation in females. -
Synonyms
Methyl CpG binding protein 2 (Rett syndrome), MeCp-2 protein, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTT, Mental retardation, X-linked 16, DKFZp686A24160.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
MECP2 although stable 4°C for 4 weeks, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
-
Amino Acid Sequence
MDYKDDDDKMVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSA
EPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAG
KYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGT
GRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMV
IKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIE
VKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVP
LLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAA
EKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV CocktailDescription:
Hepatitis C Virus Cocktail Recombinant
Product # :
HCV-015Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant HCV cocktail contains the recombinant hepatitis C virus core, NS3, NS4, NS5 proteins.
Source
Escherichia Coli.
Formulation
HCV Cocktail solution contains 25mM K2CO3 and PBS.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Applications
ELISA and lateral flow immunoassay.
-
Background
Hepatitis C virus (HCV) is a major global health concern, with approximately 71 million people infected worldwide. Chronic HCV infection can lead to liver cirrhosis, hepatocellular carcinoma, and other severe liver-related complications. The nonstructural proteins NS3, NS4, and NS5 of HCV play critical roles in viral replication, assembly, and immune evasion, making them attractive targets for antiviral interventions. This research aims to characterize the recombinant forms of HCV NS3, NS4, and NS5 proteins to gain insights into their functional properties and identify potential targets for the development of effective antiviral strategies.
The primary objective of this study is to express and purify recombinant HCV NS3, NS4, and NS5 proteins using suitable expression systems. Recombinant DNA techniques will be employed to generate expression vectors harboring the respective genes, followed by expression in bacterial, yeast, or mammalian cell-based systems. The recombinant proteins will be purified using affinity chromatography or other appropriate methods, enabling subsequent biochemical and biophysical characterization.
The second objective is to investigate the roles of NS3, NS4, and NS5 proteins in HCV replication and assembly. In vitro assays will be performed to assess the enzymatic activities of NS3 protease and NS5 RNA-dependent RNA polymerase (RdRp). The effects of potential inhibitors or small molecules on these enzymatic activities will be evaluated. Furthermore, the interactions between NS4 protein and cellular components involved in viral assembly will be explored using protein-protein interaction assays.
The third objective is to determine the three-dimensional structures of the recombinant NS3, NS4, and NS5 proteins using techniques such as X-ray crystallography or cryo-electron microscopy. Structural information will provide valuable insights into the functional domains and potential binding sites within these proteins. These findings will aid in the design of novel antiviral compounds targeting specific regions of NS3, NS4, and NS5, with the goal of disrupting viral replication and assembly.
By characterizing the recombinant forms of HCV NS3, NS4, and NS5 proteins, this research aims to enhance our understanding of the molecular mechanisms underlying HCV infection. The insights gained from this study may contribute to the development of novel antiviral strategies targeting HCV, ultimately leading to improved therapeutic options for individuals affected by this persistent and debilitating viral infection.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 PolyvalentDescription:
HIV-1 Polyvalent Recombinant
Product # :
HIV-017Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Polyvalent HIV1 antigens contain HIV1 gp41 (long sequence) and new discovered HIV1 protein P30 from HIV1 genome.
Source
Escherichia Coli.
Formulation
HIV-1 Polyvalent solution contains 25mM K2₂CO₃ & PBS.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Applications
Immunoassay.
-
Background
The Human Immunodeficiency Virus type 1 (HIV-1) continues to pose a global health challenge, with millions of individuals affected by the virus. The development of an effective HIV vaccine has been a long-standing goal in the field of virology and immunology. One promising approach is the use of polyvalent HIV-1 recombinant vaccines, which aim to target multiple viral strains and epitopes simultaneously. This research delves into the concept of polyvalent HIV-1 vaccines, shedding light on their potential to provide broad and robust protection against HIV-1 infection.
The primary objective of this research is to explore the rationale behind polyvalent HIV-1 vaccines. HIV-1 exhibits extensive genetic diversity, with multiple subtypes and circulating recombinant forms (CRFs) worldwide. Polyvalent vaccines are designed to encompass a range of viral strains, ensuring coverage against various subtypes and epitope variants. Understanding the genetic diversity of HIV-1 and the importance of polyvalent approaches is fundamental for vaccine design.
The second objective is to investigate the immunological mechanisms underlying polyvalent HIV-1 vaccines. In vitro and in vivo studies will be conducted to assess the ability of polyvalent vaccines to induce broad and cross-reactive immune responses. This includes investigations into the generation of neutralizing antibodies, cytotoxic T lymphocyte (CTL) responses, and mucosal immunity. These studies aim to elucidate the key immune correlates of protection conferred by polyvalent vaccines.
The third objective is to assess the clinical potential of polyvalent HIV-1 recombinant vaccines. Clinical trials involving diverse populations at risk of HIV-1 infection will be conducted to evaluate the safety, immunogenicity, and efficacy of polyvalent vaccine candidates. These trials may provide crucial insights into the feasibility and effectiveness of polyvalent vaccine strategies in real-world settings.
By delving into the concept of polyvalent HIV-1 recombinant vaccines, this research aims to contribute to the ongoing efforts to develop a successful HIV vaccine. The findings may provide a pathway towards a vaccine that can offer comprehensive protection against the diverse array of HIV-1 strains, bringing us closer to ending the HIV/AIDS pandemic.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Recombinant TNF-a AntibodyDescription:
Recombinant Anti Human Tumor Necrosis Factor-Alpha
Product # :
ANT-599Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- biological activity
- More Info
Description
Recombinant TNF-a Antibody is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor (TNF). Recombinant TNF-a Antibody is produced by recombinant DNA technology in a Chinese Hamster Ovary mammalian cell expression system in a serum-free medium and has a molecular weight of approximately 148 kDa.
Source
CHO.
Formulation
The Recombinant TNF-a Antibody 53mg/ml solution contains 6.16 mg/ml of sodium chloride, 0.86 mg/ml of monobasic sodium phosphate dihydrate, 1.53 mg/ml of dibasic sodium phosphate dihydrate, 0.3 mg/ml of sodium citrate, 1.30 mg/ml of citric acidmonohydrate, 12 mg/ml of mannitol, 1mg/ml of polysorbate 80, pH-5.
Purity
Greater than 98.0% as determined by:
(a) Analysis by SEC-HPLC.
(b) Analysis by SDS-PAGE.Biological Activity
The EC50 as determined by L929 cell proliferation assay for neutralization reaction between TNF-a Antibody and TNFA, Perform a comparison of a dilution series of the Sample solution with a dilution series of the Standard solution, measured potency was found to be 1.2 X 104EU/mg.More Info
-
Introduction
Tumor necrosis factor is a cytokine involved in systemic inflammation and is a member of a group of cytokines that all stimulate the acute phase reaction. TNF is mainly secreted by macrophages.
TNF causes apoptotic cell death, cellular proliferation, differentiation, inflammation, tumorigenesisand viral replication, TNF is also involved in lipid metabolism, and coagulation. TNF's primary role is in the regulation of immune cells.
Dysregulation and, in particular, overproduction of TNF have been implicated in a variety of human diseases- autoimmune diseases, insulin resistance, and cancer. -
Physical Appearance
Clear and colorless solution.
-
Stability
Recombinant TNF-a Antibody should be stored between 2-8°C and should be protected from light. DO NOT FREEZE. DO NOT SHAKE.
-
Amino Acid Sequence
LIGHT CHAIN
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDF
TLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR
EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
HEAVY CHAIN
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISR
DNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD
KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
BAG2 AntibodyDescription:
BCL2-Associated Athanogene 2, Mouse Anti Human
BAG family molecular chaperone regulator 2, BAG-2, Bcl-2-associated athanogene 2, BAG2, KIAA0576, MGC149462, dJ417I1.2.
Product # :
ANT-669Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, 10% Glycerol and 0.02% Sodium Azide.
More Info
-
Introduction
BCL2-associated athanogene 2 (BAG2) belongs to the Bag family of proteins. BAG2 is a chief component of the HSC 70/CHIP chaperone-dependent ubiquitin ligase complex and acts to upset CHIP-mediated ubiquitylation. BAG proteins compete with Hip for attaching to the Hsc70/Hsp70 ATPase domain and promote substrate discharge. All the BAG proteins have a roughly 45 amino acid BAG domain by the C-terminus but vary clearly in their N-terminal regions. The BAG domains of BAG1, BAG2, and BAG3 act together expressly with the Hsc70 ATPase domain in vitro and in mammalian cells. All three proteins attach with high affinity to the ATPase domain of Hsc70 and obstruct its chaperone activity in a Hip-repressible manner.
-
Synonyms
BAG family molecular chaperone regulator 2, BAG-2, Bcl-2-associated athanogene 2, BAG2, KIAA0576, MGC149462, dJ417I1.2.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Anti-human BAG2 mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human BAG2 protein 1-211 amino acids purified from E. coli.
-
Ig Subclass
Mouse IgG2a heavy chain and k light chain.
-
Clone
PAT29E9AT.
-
Applications
The antibody has been tested by ELISA, Western blot analysis, Flow cytometry and ICC/IF to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
BAG2 antibody was purified from mouse ascitic fluids by protein-A affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CD29 AntibodyDescription:
CD29, Mouse Anti Human
Integrin beta-1, Fibronectin receptor subunit beta, Integrin VLA-4 subunit beta, CD29 antigen, ITGB1, CD29, FNRB, MDF2, VLAB, GPIIA, MSK12.
Product # :
ANT-340Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.02% Sodium Azide and 10% Glycerol.
More Info
-
Introduction
Integrin beta 1, also known as CD29, is a 130 kDa transmembrane glycoprotein that forms noncovalent complexes with various Integrin alpha subunits (including alpha 1, alpha 2, alpha 3, alpha 4, alpha 5, and alpha 6, also known as CD49a, CD49b, CD49c, CD49d, CD49e, and CD49f, respectively) to form the functional receptors that bind to specific extracellular matrix proteins. Integrin receptors are involved in the regulation of a variety of important biological functions, including embryonic development, wound repair, hemostasis, and prevention of programmed cell death. They are also implicated in abnormal pathological states such as tumor directed angiogenesis, tumor cell growth, and metastasis. These heterodimeric receptors bridge the cytoplasmic actin cytoskeleton with proteins present in the extracellular matrix and/or on adjacent cells. The clustering of integrins on a cell surface leads to the formation of focal contacts. Interactions between integrins and the extracellular matrix l
-
Synonyms
Integrin beta-1, Fibronectin receptor subunit beta, Integrin VLA-4 subunit beta, CD29 antigen, ITGB1, CD29, FNRB, MDF2, VLAB, GPIIA, MSK12.
-
Immunogen
Anti-human CD29 mAb is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human CD29 amino acids 34-141 purified from E. coli.
-
Ig Subclass
Mouse IgG1 heavy chain and κ light chain.
-
Clone
Pk2D5AT.
-
Applications
CD29 antibody has been tested by ELISA and Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:500 ~ 1,000. Recommended starting dilution is 1:500.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
CD29 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
GAPDH AntibodyDescription:
Glyceraldehyde-3-Phosphate Dehydrogenase, Mouse Anti Human
G3PD, GAPD, MGC88685, GAPDH, Glyceraldehyde-3-Phosphate Dehydrogenase.
Product # :
ANT-005Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.
More Info
-
Introduction
GAPDH is a catalytic enzyme normally known to play a role in glycolysis. GAPDH exists as a tetramer composed of 36-kDa subunits and has a range of intracellular functions. GAPDH catalyzes the reversible reduction of 1,3-bisphosphoglycerate to glyceraldehyde 3-phosphophate in the presence of NADPH. Besides functioning as a glycolytic enzyme in cytoplasm, GAPDH has function in intracellular processes such as membrane fusion, microtubule bundling, phosphotransferase activity, nuclear RNA export, DNA replication and DNA repair. GAPDH catalyzes a vital energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.
-
Synonyms
G3PD, GAPD, MGC88685, GAPDH, Glyceraldehyde-3-Phosphate Dehydrogenase.
-
Physical Appearance
Sterile Filtered clear solution.
-
Immunogen
Anti-human GAPDH mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with recombinant human GAPDH amino acids 1-335 purified from E. coli.
-
Ig Subclass
Mouse IgG2b heavy chain and κ light chain.
-
Clone
PAT8G4AT.
-
Applications
GAPDH antibody has been tested by ELISA, Western blot and Immunofluorescence analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis and Immunofluorescence is 1:500 ~ 10,000.
Recommended starting dilution is 1:1,000. -
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
GAPDH antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Zika Envelope, sf9Description:
Zika Envelope Recombinant, sf9
Product # :
ZKV-005Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Sf9 derived recombinant Zika Envelope protein, having an Mw of approximately 50kDa.The Zika Envelope protein is fused to a 6xHis tag and purified by proprietary chromatographic technique.
Source
Sf9, Baculovirus cells.
Formulation
Zika Envelope protein contains Phosphate buffered saline, pH 7.4 and 0.09% NaN3.
Purity
Zika Envelope protein is >80% pure as determined by SDS-PAGE.
More Info
-
Introduction
Zika virus (ZIKV) belongs to the family Flaviviridae and the genus Flavivirus, it is transmitted by daytime-active Aedes mosquitoes, such as A. aegypti and A. albopictus. The Zika virus is related to the dengue, yellow fever, Japanese encephalitis, and West Nile viruses. Much like the other flaviviruses, Zika virus is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Zika fever is an infection, which often causes no symptoms or only mild ones, like a mild form of dengue fever, and it is treated by rest. As of February 2016, there has been mounting evidence that Zika fever in pregnant women can cause abnormal brain development in their fetuses by mother-to-child transmission, which may result in miscarriage or microcephaly, however it is not yet known whether Zika virus causes microcephaly. Furthermore, a connection has been established with neurologic conditions in infected adults, including Guillain–Barre syndrome.
-
Physical Appearance
Sterile Filtered solution.
-
Stability
Zika Envelope protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Each laboratory should determine an optimum working titer for use in its particular application.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
BDNF AntibodyDescription:
Brain-Derived Neurotrophic Factor, Mouse Anti-Human
BDNF, MGC34632.
Product # :
ANT-128Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
BDNF promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the cns. the versatility of bdnf is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (ltp), long-term depression (ltd), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
-
Synonyms
BDNF, MGC34632.
-
Solubility
Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
r.Human BDNF.
-
Ig Subclass
Mouse IgG Purification MethodIon exchange.
-
Clone
NYRhBDNF.
-
Titer
By direct ELISA, 1:10,000 dilution will yield 0.4 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4oC in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20oC.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CD44 Anti-Human, FITCDescription:
CD44, Mouse Anti-Human FITC
MDU2, MDU3, MIC4, CDW44, CSPG8, HCELL, HUTCH-I, Phagocytic glycoprotein I, PGP-1, Extracellular matrix receptor-III, ECMR-III, Hermes antigen, Hyaluronate receptor, Heparan sulfate proteoglycan, Epican) CDw44.
Product # :
ANT-244Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
CD44 is a cell-surface glycoprotein that plays a role in cell-cell interactions, cell adhesion and migration. CD44 is a receptor for hyaluronic acid and also interacts with other ligands, such as osteopontin, collagens, and matrix metalloproteinases. CD44 participates in a wide variety of cellular functions such as lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. CD44 and CD49d are putative activity markers and CD44 a potential novel therapeutic target in multiple sclerosis. Increased CD44 antigen is associated with relapses in non-small cell lung cancers.
-
Synonyms
MDU2, MDU3, MIC4, CDW44, CSPG8, HCELL, HUTCH-I, Phagocytic glycoprotein I, PGP-1, Extracellular matrix receptor-III, ECMR-III, Hermes antigen, Hyaluronate receptor, Heparan sulfate proteoglycan, Epican) CDw44.
-
Solubility
Reconstitute with of H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Purified human T-Cells.
-
Ig Subclass
Mouse IgG2a.
-
Clone
hCD44.
-
Applications
Staining antibody. For staining, use 5-10µl/1,000,000 cells.
-
Available Conjugates
is antibody is also available conjugated to biotin and FITC. For staining with biotin or FITC-conjugated antibody use 5-10µl/106 cells.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
Lyophilized: store at 4°C. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Protein-A.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
VEGF AntibodyDescription:
Vascular Endothelial Cell Growth Factor, Mouse Anti-Human
Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Product # :
ANT-125Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- More Info
More Info
-
Introduction
Vascular endothelial growth factoris an important signaling proteininvolved in both vasculogenesisand angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g. stimulation monocyte/macrophagemigration, neurons, cancer cells, kidney epithelial cells ).VEGF mediates increased vascular permeability, induces angiogenesis, vasculogenesis and endothelial cell growth, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesisand cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor.
Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. -
Synonyms
Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
-
Solubility
Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
r.HumanVEGF.
-
Ig Subclass
Mouse IgM.
-
Clone
NYRhVEGF.
-
Applications
Direct ELISA, Western Blot, Immuneprecipitation.
-
Titer
By direct ELISA, 1:10,000 dilution will yield 0.15 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4oC in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20oC.
-
Purification Method
Boric acid precipitation Protein concentration1mg/ml in PBS (after reconstitution).
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
IL 2r Antibody, FITCDescription:
Mouse Anti Human Interleukin-2 receptor FITC
CD25, IL2R, TCGFR, IL-2RA, sIL-2RA, TAC antigen, sIL-2R, IDDM10, p55 TypeMouse Anti Human Monoclonal.
Product # :
ANT-072Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
IL2-Ra is one of the three constituent subunits of the IL2 receptor. IL-2Ra is released into the serum after increased cellular expression such as increased activation of B and T cells. Clinical manifestations of IL2-Ra elevation include autoimmune conditions and some leukemias and lymphomas.
-
Synonyms
CD25, IL2R, TCGFR, IL-2RA, sIL-2RA, TAC antigen, sIL-2R, IDDM10, p55 TypeMouse Anti Human Monoclonal.
-
Solubility
Reconstitute with sterile H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Con A-activated human T cells.
-
Ig Subclass
Mouse IgG2a.
-
Clone
YNRhIL2R.
-
Titer
This antibody will stain 70% of PHA-activated human T cells (by FACS). 10µl will stain 106 IL-2R positive cells for FACS analysis or sorting.
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Storage Procedures
In lyophilized form, for long periods, store at 4°C in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Ion Exchange.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
ESR1 AntibodyDescription:
Estrogen Receptor Alpha, Mouse Anti Human
ER-alpha
Product # :
ANT-473Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
Estrogen receptors α (ERα, ER; NR3A1) is a member of the steroid hormone receptor family. ERα is a ligand-activated transcription factor. ERα contain DNA binding and ligand binding domains. ERα is expressed in a wide variety of tissues, including ovary, uterus, breast, prostate, testis, epididymis, bones, bladder, kidney, heart, vessel wall, pituitary gland and hypothalamus. ER plays a variety of important roles in the maintenance of the reproductive, cardiovascular, musculoskeletal and central nervous systems. The natural ligand for ER is 17β-estradiol, the classical estrogenic compound. The binding of estrogen to ER induces a conformational change and triggers a cascade of events, including dissociation from heat shock proteins, receptor dimerization, phosphorylation and the association of the hormone activated receptor with specific regulatory elements in target genes.
-
Synonyms
ER-alpha
-
Solubility
Reconstitute with of H2O. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Recombinant human ER-alpha.
-
Ig Subclass
Mouse IgG.
-
Clone
LSERASC1.
-
Applications
Western Blot, Immunofluorescent Staining, Immunohistochemistry, flow cytometry, immunoprecipitation.
-
Available Conjugates
This antibody is only available as purified antibody.
-
Type
Mouse anti-Estrogen Receptor Alpha (human and mouse).
-
Storage Procedures
Lyophilized: store at 4°C. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Protein A.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CD8 AntibodyDescription:
CD8, Rat Anti-Mouse
CD8, MAL, p32.
Product # :
ANT-280Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
CD8 is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. CD8 acts as a co-receptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional CD8 is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains.
CD8 identifies cytotoxic/suppressor t-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of t-cell mediated killing. CD8 alpha chains bind to class-I MHC molecules alpha-3 domains. -
Synonyms
CD8, MAL, p32.
-
Solubility
Reconstitute with of H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
Purified Mouse LN T cells.
-
Ig Subclass
Rat IgM.
-
Clone
NYRmCD8.
-
Applications
Cytotoxic and staining antibody. For staining, use 10µl/1,000,000 cells. Titer for cytotoxicity should be determined by the investigator.
-
Available Conjugates
This antibody is only available conjugated to Biotin and FITC.
-
Type
Rat Anti Mouse Monoclonal.
-
Storage Procedures
Lyophilized: store at 4°C. After reconstitution, if not intended for use within a month, aliquot and store at -20°C.
-
Purification Method
Ion Exchange Column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
MPO HumanDescription:
Myeloperoxidase Human
Myeloperoxidase, EC 1.11.1.7, MPO.
Product # :
ENZ-074Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
MPO is a natural protein having a molecular mass of 150kDa containing 2 subunits each of a heavy chain with 64kDa and a light chain with 13kDa. MPO is isolated from human peripheral blood polymorphonuclear leukocytes.
Source
Human peripheral blood polymorphonuclear leukocytes.
Formulation
MPO solution is supplied in 20mM HEPES buffer pH-7.5, 200mM NaCl and 20% glycerol.
Purity
Greater than 80% as determined by SDS-PAGE.
More Info
-
Introduction
Myeloperoxidase is an important enzyme used by granulocytes during phagocytic lysis of foreign particles engulfed. In normal tissues and in a variety of myeloproliferative disorders myeloid cells of both neutrophilic and eosinophilic types, at all stages of maturation, exhibit strong cytoplasmic reactivity for MPO. Erythroid precursors, megakaryocytes, lymphoid cells, mast cells, and plasma cells are nonreactive. MPO is not observed in the neoplastic cells of a wide variety of epithelial tumors and sarcomas. MPO is useful in differentiating between myeloid and lymphoid leukemias.
-
Synonyms
Myeloperoxidase, EC 1.11.1.7, MPO.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.