Search results
805 results found for “helicobacter pylori”
Name
Description
Product #
Price
Quantity
Shipping Method
- View Data Sheet
Name :
FAS Antibody (CD95)Description:
FAS Antibody (CD95), Mouse Anti Human
FASLG receptor, Apoptosis-mediating surface antigen FAS, Apo-1 antigen, CD95, Tumor necrosis factor receptor superfamily member 6 TNR6, APT1, FAS1, TNFRSF6.
Product # :
ANT-735Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1X PBS pH 7.4, 0.5% Saccharose, 0.2% gelatin and 0.1% NaN3.
More Info
-
Introduction
The Fas receptor (CD95) mediates apoptotic signaling by Fas-ligand expressed on the surface of other cells. The Fas-FasL interaction plays an important role in the immune system and lack of this system leads to autoimmunity, indicating that Fas-mediated apoptosis removes self-reactive lymphocytes. Fas signaling is also involved in immune surveillance to remove transformed cells and virus infected cells. Binding of FAS to oligimerized FasL on another cell activates apoptotic signaling through a cytoplasmic domain termed the death domain that interacts with signaling adaptors including FAF, FADD and DAX to activate the caspase proteolytic cascade. Caspase-8 and caspase-10 are first activated, to then cleave and activate downstream caspases, and a variety of cellular substrates that lead to cell death. Caspases cleave nuclear lamins, causing the nucleus to break down and lose its normal structure and another caspase substrate is DFF, inducing cleavage and degradation of the genome. Other caspase substrates are involved in cytoskeletal structure, cell cycle regulation and signaling pathways. Activation of JNK kinase, activation of Jun, and production of ceramide may also play roles in Fas-mediated apoptosis. Activation of fas-mediated apoptosis is opposed by I-FLICE and FAP. Viruses and tumors may escape immune surveillance in part through suppression of fas-mediated apoptosis using similar mechanisms.
-
Synonyms
FASLG receptor, Apoptosis-mediating surface antigen FAS, Apo-1 antigen, CD95, Tumor necrosis factor receptor superfamily member 6 TNR6, APT1, FAS1, TNFRSF6.
-
Physical Appearance
Sterile filtered colorless solution.
-
Immunogen
Recombinant Human FAS.
-
Ig Subclass
Mouse IgG2a
-
Clone
pprro-160
-
Applications
FAS Antibody can be used in Flow cytometry.
-
Type
Mouse Anti Human Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
Protein-A column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Polyvalent ELISADescription:
Polyvalent Dengue Antigen-I for ELISA Recombinant
Product # :
DEN-027Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Polyvalent dengue antigens are 18kDa proteins containing subtype 1,2,3 and 4 and each of them has equal amount protein. They are a new group of antigens specifically designed for ELISA assay. All the recombinant peptides are fused with a 6xHis Tag. Polyvalent dengue is purified by proprietary chromatographic technique.
Source
Escherichia Coli.
Formulation
Phosphate buffered saline, pH-9.4 and 25mM K₂CO₃.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Polyvalent dengue Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CoV-2 OmicronDescription:
Coronavirus 2019 Omicron Full Length Recombinant
Product # :
SARS-059Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the Omicron Covid-19 full-length nucleprotein, fused to 6xHis tag at N-terminal migrating at 48 kDa.
Source
Escherichia Coli.
Formulation
CoV-2 Omicron protein solution (2.18mg/ml) is supplied in PBS and 25mM K2CO3.
Purity
Protein is >95% pure as determined SDS-PAGE.
More Info
-
Introduction
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.
The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.
On November 2021, WHO designated a variant of concern, named Omicron. Omicron has several mutations that may have an impact on how it behaves (how easily it spreads, the severity of illness). -
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Protein is shipped on ice packs. Upon arrival, Store at -20°C.
-
Amino Acid Sequence
HMSDNGPQNQ RNALRITFGG PSDSTGSNQN GEARSKQRRP QGLPNNTASW FTALTQHGKE DLKFPRGQGV PINTNSSPDD QIGYYRRATR RIRGGDGKMK ELSPRWYFYY LGTGPEAGLP YGANKDGIIW VATEGALNTP KDHIGTRNPA NNAAIVLQLP QGTTLPKGFY AEGSRGGSQA SSRSSSRSRN SSRNSTPGSS KRTSPARMAG NGGDAALALL LLDRLNQLES KMSGKGQQQQ GQTVTKKSAA EASKKPRQKRT ATKAYNVTQA FGRRGPEQTQ GNFGDQELIR QGTDYKHWPQ IAQFAPSASA FFGMSRIGME VTPSGTWLTY TGAIKLDDKD PNFKDQVILL NKHIDAYKTF PPTEPKKDKK KKADETQALP QRQKKQQTVT LLPAADLDDF SKQLQQSMSS ADSTQA
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS3 Genotype-2cDescription:
Hepatitis C Virus NS3 Genotype-2c, (1192-1459 a.a.) Recombinant
Product # :
HCV-209Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein fused to a His tag contains the HCV NS3 immunodominant regions, amino acids 1192-1459.
Formulation
1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS3 Genotype-2c protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS3 Genotype-2c although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS3 Genotype-2c antigen is suitbale for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS3 Genotype-2c protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Envelope-1 15kDaDescription:
Dengue Virus Subtype 1 Envelope 15kDa, C-Terminal (Domain III) Recombinant
Product # :
DEN-011Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant 15kDa protein is genetically engineered peptide which is derived from C terminus of Dengue Type-1 envelope. The expressed protein contains neutralizing epitopes and receptor binding domain, it has been used in the study for vaccine development. A 6 x His Tag is fused at its C-terminus.
Source
Escherichia Coli.
Formulation
1xPBS, 0.02% sodium nitrate and 25mM k2CO3.
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Dengue Envelope-ST1 D-III although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Each laboratory should determine an optimum working titer for use in its particular application.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Envelope-1 32kDaDescription:
Dengue Virus Subtype 1 Envelope 32kDa Recombinant
Product # :
DEN-014Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Dengue Virus Subtype 1 Envelope 32kDa containing domains I+II of the dengue envelope, produced in E.coli and fused with a 6xHis Tag.
Source
E.coli.
Formulation
Phosphate buffered saline, pH-7.4.
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Dengue fever is affected by 1 of 4 closely linked virus serotypes of the genus Flavivirus, family Flaviviridae. One might have dengue fever infected by the different serotype virus after the primary infection. Detection of particular antibodies to dengue viruses is used for the diagnosis in clinic. Recently, lateral flow rapid test products have become a most suitable and known method in the clinical diagnosis. Though, there is difficulty for manufacturers to have the dengue antigens with a whole coverage for Dengue IgG & IgM recognition for all 4 serotype infections as well as with colloid gold binding ability. 8 dengue antigens have been established for the lateral flow products which are well defined for their coverage of dengue IgG & IgM recognition. The researcher can select the products below based on their own specific application.
-
Stability
Dengue Envelope-1 32kDa although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Immunoassay.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Envelope-2 22kDaDescription:
Dengue Virus Subtype-2 Envelope 22kDa Recombinant
Product # :
DEN-007Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant 22 kDa protein is genetically engineered peptide which is derived from Dengue Type-2 Envelope. This region also contains a common antigen for Dengue IgG & IgM. This protein is fused to 6xHis tag.
Source
Escherichia Coli.
Formulation
Phosphorous buffered saline, pH-7.4.
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Dengue Envelope ST2 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Each laboratory should determine an optimum working titer for use in its particular application.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Envelope-3 22kDaDescription:
Dengue Virus Subtype-3 Envelope 22kDa Recombinant
Product # :
DEN-008Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Dengue Envelope ST3 is a dengue antigen specially designed for ELISA test, this 22 kDa recombinant peptide contains important epitopes for dengue IgG & IgM antibody recognition and is fused with 6-His fusion partner.
Source
Escherichia Coli.
Formulation
Phosphate buffered saline, pH-7.4.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Dengue Envelope ST3 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Immunoassay.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS3 Genotype-6Description:
Hepatitis C Virus NS3 Genotype-6, (1356-1459 a.a.) Recombinant
Product # :
HCV-254Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to a GST tag at N-Terminus.
Formulation
1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS3 Genotype-6 protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS3 Genotype-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS3 Genotype-6 antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS3 Genotype-6 protein was Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS5 Genotype-2Description:
Hepatitis C Virus NS5 Genotype-2 Recombinant
Product # :
HCV-229Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS5 Genotype2 immunodominant regions.
Formulation
25mM Tris and 1mM EDTA, 1.5M urea & 50% glycerol.
Purity
HCV NS5 Genotype-2 protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Physical Appearance
Sterile Filtered clear solution.
-
Stability
HCV NS5 Genotype-2 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS5 Genotype-2 antigen is syuitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS5 Genotype-2 protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 p24 CoreDescription:
HIV-1 p24 Core Recombinant
Product # :
HIV-103Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HIV-1 p24 Core is a 24kDa non-glycosylated polypeptide chain, containing the full length sequence of the HIV-1 p24.
Source
Escherichia Coli.
Formulation
50mM Tris, pH 8.5 and 8M urea.
Purity
Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
More Info
-
Introduction
Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
-
Physical Appearance
Sterile filtered colorless clear solution.
-
Stability
HIV-1 p24 core although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Specificity
Immunoreactive with all sera of HIV-1 infected individuals.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS5 Genotype-2bDescription:
Hepatitis C Virus NS5 Genotype-2b Recombinant
Product # :
HCV-231Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS5 Genotype 2b immunodominant regions, amino acids 2212-2313. The protein is fused to a GST tag at N-Terminus.
Source
Escherichia Coli.
Formulation
1.5M urea, 25 mM Tris-HCl, pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS5 Genotype-2b protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS5 Genotype-2b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS5 Genotype-2b antigen in ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS5 Genotype-2b protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
C4c HumanDescription:
Complement Component C4c Human
Complement C4c, Complement Component C4c, C4c.
Product # :
PRO-556Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Human C4c produced in Human plasma having a molecular mass of 210 kDa.
Source
Human Plasma.
Formulation
The Human Complement C4c solution is in Sodium Phosphate buffer pH 7.0 containing 0.15M NaCl and 0.09% NaN3.
Purity
Greater than 99.0%.
More Info
-
Introduction
Complement C4c is a degradation product of C4b which is cleaved by C4b/C3b inactivator to yield C4d and C4c.
Complement C4c interacts with C1 and C2 to form C3 convertase of the classic activation pathway. Systemic lupus erythematosus (SLE) is often associated with congenital C4 deficiency. Reduced levels of components of the classic pathway (C1, C2, C4, C3) are common after such activation, e.g. in SLE, acute serum sickness and conditions associated with circulating immune complexes. -
Synonyms
Complement C4c, Complement Component C4c, C4c.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Human C4c although stable at 4°C for 1 week, should be stored at -15°C.Please avoid freeze-thaw cycles.
-
Human Virus Test
Plasma from each donor has been tested and found negative for HIV-1 & 2 antibodies, Hepatatis B surface antigen, and Hepatatis C antibodies.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
StreptavidinDescription:
Streptavidin Recombinant
Product # :
PRO-791Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- description
- source
- formulation
- purity
- More Info
Description
Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa.
Source
Escherichia Coli.
Formulation
Lyophilized in 10mM potassium phosphate buffer pH 6.5.
Purity
Greater than 98.0% as determined by SDS-PAGE and HPLC.
More Info
-
Introduction
Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.
-
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
-
Stability
Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
-
Solubility
It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H2O not less than 0.5mg/ml, which can then be further diluted to other aqueous solutions.
-
Amino Acid Sequence
MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLT
GRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGA
EARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS. -
Proteolytic Activity
< 10-3 U/mg protein (Azocoll, 25 °C, 24 h, pH 8.0).
-
Specific Activity
> 17U/mg (one unit binds 1 μg D-biotin).
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Control AntibodyDescription:
Monoclonal Mouse Anti Dengue Control for Lateral Flow Test
Product # :
ANT-543Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Monoclonal Mouse Anti Dengue Control for Lateral Flow Test. Used to prepare a control line for dengue IgG/IgM rapid test, coating concentration is 0.4-0.5mg/ml, 1µl/cm.
Formulation
10mM phosphate buffered saline pH-7.2.
Purity
90% pure (12% SDS-PAGE and Coomassie staining).
More Info
-
Physical Appearance
Sterile Filtered clear colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Applications
Immunoassay.
-
Purification Method
Purified monoclonal IgG by protein A chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Ara h 1.0101Description:
Allergen Ara h 1.0101 Recombinant
Allergen Ara h 1, clone P41B, Allergen Ara h I, Allergen, Ara h 1.
Product # :
ALR-006Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Allergen Ara h 1.0101 produced in SF9 is a glycosylated, polypeptide chain having a calculated molecular mass of 63,484 Dalton. Ara h 1.0101 is expressed with a 9xHis tag at N-terminus and purified by proprietary chromatographic techniques.
Source
Sf9 insect cells.
Formulation
Ara h 1.0101 is supplied in 20mM HEPES buffer pH-8.0, 100mM Nacl and 6M Urea.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Ara h 1 is a seed storage protein from Arachis hypogaea which causes an allergic reaction in human. Ara h 1 is found in 95% of peanut allergic patients from North America. Nevertheless, peanut-allergic patients of European populations have fewer sensitizations to Ara h 1.
-
Synonyms
Allergen Ara h 1, clone P41B, Allergen Ara h I, Allergen, Ara h 1.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
-
Immunological Functions
1. Binds IgE type human antibodies. 2. Immunodot test with positive/negative sera panels.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS5 Genotype-5Description:
Hepatitis C Virus NS5 Genotype-5 Recombinant
Product # :
HCV-223Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS5 Genotype 5 immunodominant regions, amino acids 2212-2313.
Formulation
1.5M urea, 25 mM Tris-HCl, pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS5 Genotype-5 protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS5 Genotype-5 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS5 Genotype-5 antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS5 Genotype-5 protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Rubella Virus CapsidDescription:
Rubella Virus Capsid Recombinant
Product # :
RUB-294Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant Rubella Virus Capsid is a 35kDa protein which is fused to a His tag in N-terminus.
Source
Escherichia Coli.
Formulation
25mM K2CO3 and PBS.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Rubella Virus Capsid although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Background
The Rubella Capsid Protein is responsible for encapsidating the viral RNA genome, forming the nucleocapsid structure, which is crucial for viral assembly and replication. Studies using recombinant capsid protein have demonstrated its ability to self-assemble into virus-like particles (VLPs), which mimic the native structure of the virus and are valuable for studying viral assembly. The capsid protein is a major target of the host immune response during rubella infection. Recombinant Rubella Capsid Protein has been used to investigate the humoral and cellular immune responses it elicits. Understanding these immune responses is critical for improving vaccine design and developing diagnostic assays to detect rubella-specific antibodies.
-
Specificity
Immunoassay.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue-2 C-terminalDescription:
Dengue-2 Envelope Hydrophobic Domain Recombinant
Product # :
DEN-039Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The Recombinant Dengue 2 Envelope Hydrophobic Domain e.coli derived contains 225 amino acids (228-485) from dengue 2 envelope. The protein is fused to a His tag at C-terminal and purified by standard chromatography techniques.
Source
E.coli.
Formulation
PBS.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Dengue 2 Envelope Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Immunoassay.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
SARS Nucleocapsid, 1-49 a.a.Description:
SARS-Associated Coronavirus Nuclecapsid (1-49 a.a.), Recombinant
Product # :
SARS-005Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the Nucleocapsid protein 1-49 amino acids immunodominant regions.
Source
Escherichia Coli.
Formulation
SARS Nucleocaspid protein solution is supplied in PBS.
Purity
Protein is >90% pure as determined SDS-PAGE.
More Info
-
Introduction
The SARS Nucleocaspid is a protein that has a crucial structural importance, by making the virions associates with the RNA genome and therefore create a nucleocapsid that has the specific helical form. There has been found 3 different domain structures to the nucleocapsid antigen. This protein contains 3 outer structural proteins, the membrane (M), envelope (E), and spike (S) proteins.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Protein is shipped on ice packs. Upon arrival, Store at -20°C.
-
Specificity
Immunoreactive with sera of SARS-infected individuals.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CFH RatDescription:
Complement Factor H Rat
Complement factor H, H factor 1, CFH, HF, HF1, HF2.
Product # :
PRO-2709Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Rat Complement Factor H produced in Rat plasma having a total molecular mass of 155kDa.
Source
Rat Plasma.
Formulation
CFH protein solution contains phosphate Buffered Saline, pH 7.2.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Complement factor H (CFH) is an important regulatory component of the alternative pathway of complement. CFH is prevents complement activation on host cells and tissues, mainly the kidney. CFH controls the formation and decay of the alternative pathway C3/C5 convertase and acts as a cofactor for factor I which proteolytically inactivates C3b when C3b is bound to factor H. The N-terminal 5 domains of CFH bind to C3b and inhibit binding of factor B thus reducing the formation of C3/C5 convertase. CFH also binds to preformed C3/C5 convertases and causes quick release of the catalytic subunit Bb. These activities are necessary for controlling the spontaneous activation of the alternative pathway amplification process in plasma. In addition, CFH controls the formation and decay of these enzymes when C3b is attached to the surface of particles.
-
Synonyms
Complement factor H, H factor 1, CFH, HF, HF1, HF2.
-
Physical Appearance
Sterile filtered solution.
-
Stability
CFH Rat is stable at 4°C if entire vial will be used within 2-4 weeks.Store, frozen below -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS3 Genotype-2bDescription:
Hepatitis C Virus NS3 Genotype-2b, (1192-1459) Recombinant
Product # :
HCV-210Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein fused to a His tag contains the HCV NS3 immunodominant regions, amino acids 1192-1459.
Formulation
1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS3 Genotype-2b protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS3 Genotype-2b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS3 Genotype-2b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS3 Genotype-2b protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS5 Genotype-2aDescription:
Hepatitis C Virus NS5 Genotype-2a Recombinant
Product # :
HCV-230Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS5 Genotype 2a immunodominant regions, amino acids 2212-2313. The protein is fused to a GST tag at N-terminus.
Formulation
1.5M urea, 25 mM Tris-HCl, pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS5 Genotype-2a protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS5 Genotype-2a although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS5 Genotype-2a antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS5 Genotype-2a protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HTLV-1 EnvelopeDescription:
HTLV-1 Envelope Recombinant
Product # :
HIV-107Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the C- terminus of gp46 and most of p21E of HTLV-1. This non-fusion, E. coli-derived protein, starts from HTLV-1 env. Amino acid 165, and is ending in amino acid 440, Mw 27 kDa.
Formulation
10mM Na-PO4 pH 6.0, 0.1% SDS and 1mM DTT.
Purity
HTLV-1 Envelope protein is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
More Info
-
Introduction
Human T-lymphotropic virus (HTLV) is a human, single-stranded RNA retrovirus that causes T-cell leukemia and T-cell lymphoma. The virus activates a subset of T-helper cellscalled Th1cells. The result is a proliferation of Th1 cells and overproduction of Th1 related cytokines (mainly IFN-gamma and TNF-alpha). Feedback mechanisms of these cytokines cause a suppression of the Th2 lymphocytes and a reduction of Th2 cytokine production (mainly IL-4, IL-5, IL-10 and IL-13). The end result is a reduction in the ability of the infected host to mount an adequate immune response to invading organisms that require a predominantly Th2 dependant response (these include parasitic infections and production of mucosal and humoral antibodies).
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Purification Method
HTLV-1 Envelope was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.