Search results
550 results found for “related ras viral (r-ras) oncogene”
Name
Description
Product #
Price
Quantity
Shipping Method
- View Data Sheet
Name :
RERG HumanDescription:
RAS-like, Estrogen-Regulated, Growth Inhibitor Human Recombinant
Ras-related and estrogen-regulated growth inhibitor, RERG, MGC15754.
Product # :
PRO-106Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
RERG Human Recombinant fused with a 20 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 219 amino acids (1-199 a.a.) and having a molecular mass of 24.7kDa (Molecular size on SDS-PAGE will appear higher). The RERG is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The RERG solution (0.25 mg/ml) contains 20mM Tris-HCl buffer (pH8.0), 0.2M NaCl, 5mM DTT and 50% glycerol.
Purity
Greater than 85.0% as determined by SDS-PAGE.
More Info
-
Introduction
RERG is a 199 amino acid protein which localizes in the cytoplasm and is a member of the Ras subfamily of small GTPases. RERG is expressed in the pancreas, liver, skin, lung, brain, kidney and heart tissue. RERG is a vital mediator of diverse cell signaling pathways, including those leading to cell proliferation, cytoskeletal organization and secretion.
-
Synonyms
Ras-related and estrogen-regulated growth inhibitor, RERG, MGC15754.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MAKSAEVKLA IFGRAGVGKS ALVVRFLTKR FIWEYDPTLE STYRHQATID DEVVSMEILD TAGQEDTIQR EGHMRWGEGF VLVYDITDRG SFEEVLPLKN ILDEIKKPKN VTLILVGNKA DLDHSRQVST EEGEKLATEL ACAFYECSAC TGEGNITEIF YELCREVRRR RMVQGKTRRR SSTTHVKQAI NKMLTKISS.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Chlamydia W4-W5Description:
Chlamydia Trachomatis W4-W5 Recombinant
Product # :
CHT-004Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant 6xHis fusion at C-terminus protein contains Chlamydia Trachomatis MOMP protein epitopes, 191-354 amino acids.
Source
Escherichia Coli.
Formulation
10mM Tris-HCl, pH 6.5, 100mM Sodium Phosphate and 8M urea.
Purity
Chlamydia W4-W5 protein is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
More Info
-
Introduction
Chlamydia is a common term for infection with any bacterium belonging to the phylum Chlamydiae. This term derives from the name of the bacterial genus Chlamydiain the family Chlamydiaceae, order Chlamydiales, class and phylum Chlamydiae. There are two genera in Chlamydiaceae: Chlamydia and Chlamydophila. The genus Chlamydia includes three species: C. trachomatis, C. muridarum, and C. suis.
-
Stability
Chlamydia W4-W5 protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Chlamydia W4-W5 is suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.
-
Specificity
Immunoreactive with sera of Chlamydia Trachomatis infected individuals.
-
Purification Method
Chlamydia W4-W5 protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Zika Envelope, sf9Description:
Zika Envelope Recombinant, sf9
Product # :
ZKV-005Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Sf9 derived recombinant Zika Envelope protein, having an Mw of approximately 50kDa.The Zika Envelope protein is fused to a 6xHis tag and purified by proprietary chromatographic technique.
Source
Sf9, Baculovirus cells.
Formulation
Zika Envelope protein contains Phosphate buffered saline, pH 7.4 and 0.09% NaN3.
Purity
Zika Envelope protein is >80% pure as determined by SDS-PAGE.
More Info
-
Introduction
Zika virus (ZIKV) belongs to the family Flaviviridae and the genus Flavivirus, it is transmitted by daytime-active Aedes mosquitoes, such as A. aegypti and A. albopictus. The Zika virus is related to the dengue, yellow fever, Japanese encephalitis, and West Nile viruses. Much like the other flaviviruses, Zika virus is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Zika fever is an infection, which often causes no symptoms or only mild ones, like a mild form of dengue fever, and it is treated by rest. As of February 2016, there has been mounting evidence that Zika fever in pregnant women can cause abnormal brain development in their fetuses by mother-to-child transmission, which may result in miscarriage or microcephaly, however it is not yet known whether Zika virus causes microcephaly. Furthermore, a connection has been established with neurologic conditions in infected adults, including Guillain–Barre syndrome.
-
Physical Appearance
Sterile Filtered solution.
-
Stability
Zika Envelope protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Each laboratory should determine an optimum working titer for use in its particular application.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV Core Genotype-4Description:
Hepatitis C Virus Core Genotype-4 Recombinant
Product # :
HCV-216Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. The protein is fused to a GST tag at N-Terminus.
Formulation
50mM Tris-HCl, pH-8, 60mM NaCl, 10mM glutathione, 0.25% sarkosil & 50% glycerol.
Purity
HCV Core Genotype-4 protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV Core Genotype-4 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV Core Genotype-4 atigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV Core Genotype-4 protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Epitope 13Description:
Dengue Multiple Epitopes 13 Recombinant
Product # :
DEN-043Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Dengue Multiple Epitopes 13 is genetically designed dengue multiple epitopes epi-13 designed especially for lateral flow product, they are selected from dengue genome. The rapid test prepared by this antigen has over 90% sensitivity and specificity over 90% to show quick and strong signal for both dengue IgM and IgG.
Source
Escherichia Coli.
Formulation
Phosphate buffered saline, pH 7.4 and 0.02% sodium nitrate.
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue NS1, ST4Description:
Dengue Virus NS1 Recombinant, Subtype-4
Product # :
DEN-017Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the NS1 Dengue Virus full length Type-4 immunodominant regions, migrates as 45kDa on 12% SDS-PAGE gel.The dengue protein is fused to a 6xHis tag at C-terminus.
Formulation
Phosphate buffered saline and 50mM arginine.
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Dengue NS1, ST4 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Each laboratory should determine an optimum working titer for use in its particular application.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue NS1, ST3Description:
Dengue Virus NS1 Recombinant, Subtype-3
Product # :
DEN-016Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the NS1 Dengue Virus full length Type-3 immunodominant regions, migrates as 45kDa on 12% SDS-PAGE gel.The dengue protein is fused to a 6xHis tag at C-terminus.
Source
Escherichia Coli.
Formulation
Phosphate buffered saline and 50mM arginine.
Purity
Protein is >90% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Dengue NS1, ST3 although stable at 4°C for 1 week, should be stored below -18°C.Please prevent freeze thaw cycles.
-
Applications
Immunoassay.
-
Purification Method
Purified by proprietary chromatographic technique
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 ProteaseDescription:
HIV-1 Protease Recombinant
Product # :
HIV-001Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HIV-1 protease is an active homodimer having a molecular mass of 21.6kDa (each monomer of 99 amino acids is 10.8kDa).
The HIV-1 has His-Tag at C-terminus and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The HIV-1 Protease filtered (0.4µm) solution is formulated in 20mM Tris, 20mM MES, 200mM NaCl, 1mM EDTA, 10% (v/v) glycerol and 0.05% 2-mercaptoethanol, pH 6.5.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
HIV-1 protease is very significant in the life cycle of the HIV virus. It is expressed in the infected cells as a part of Gag-Pol polyprotein from which it is auto-catalytycaly released after formation of an immature viral particle. The enzyme subsequently cleaves the other parts of viral polyproteins resulting in the maturation of the virus. In HIV-infected patients the enzyme is subjected to intensive mutagenesis and mutants resistant to applied medicines are produced as a result of the selection pressure.
-
Physical Appearance
Sterile filtered colorless clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.
-
Amino Acid Sequence
PQITLWQRPL VTIKIGGQLK EALLDTGADD TVLEEMNLPG RWKPKMIGGI GGFIKVRQYDQILIEICGHK AIGTVLVGPT PVNIIGRNLL TQIGCTLNFHHHHHH.
-
Kinetic parameters
Km=15.1µM, Kcat = 30s-1, Kcat/Km= 1981 mM-1s-1 with peptide substrate KARVF (NO2)VRKA (F(NO2) ... p-nitrophenylalanine).
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 p24 antibodyDescription:
HIV-1 p24 Mouse antibody
Product # :
ANT-152Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
-
Solubility
Reconstitute with H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
r.HIV-1p24.
-
Ig Subclass
mouse IgG1.
-
Clone
YDHIV1gp24.
-
Titer
By direct ELISA (against recombinant gp24), 1:10,000 dilution will yield 0.4 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse antibody Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4C in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20C.
-
Purification Method
Ion exchange column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 ShandongDescription:
H3N2 Influenza-A Virus Shandong/9/93
Product # :
IHA-004Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza A virus, strain A/Shandong/9/93. The Influenza Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The H3N2A/ Shandong/9/93 solution (1.0mg/ml) contains STE, 0.1% sodium azide (NaN3) and 0.005% thimerosal.
Stir thoroughly prior to its use.
Purity
Greater than 90.0%.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2and H3N2 strains contained genesfrom avian influenzaviruses.
-
Physical Appearance
Opaque suspension.
-
Stability
A/Shandong/9/93 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatmentThis product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Serological studies of influenza A virus, immunogen for antibody production.Tested with anti-influenza A monoclonal antibodies in ELISA.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
1F8 ChagasDescription:
1F8 Chagas Recombinant
Product # :
CCH-002Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Chagas 1F8 protein (Epitope of the flagellar calcium-binding protein FCABP of Trypanosoma cruzi) produced in E.Coli, is a polypeptide chain having a total of 234 a.a (includes his tag). The protein is fused to a 6-His tag having a total Mw of 25.8kDa and a theoretical pI of 5.39.
Source
Escherichia Coli.
Formulation
1F8 Chagas antigen was lyophilized from 20mM Hepes, 300mM NaCl, pH-8, and varying 284mM imidazole.
Purity
Protein is >90% pure as determined by SDS PAGE.
More Info
-
Introduction
Flagellar calcium-binding protein (Protein FcaBP) is a protein which may be involved in swift motility of Trypanosoma, having an imperative role in flagellar structure and calcium metabolism, as it exhibits 4 EF-hand type (helix-loop-helix) structural domains, of which 3 may contain calcium-binding sites. Calcium has a vital role in the motility of Trypanosoma. The subcellular localization of Protein FcaBP is in the flagella of T. cruzi.
-
Stability
Store lyophilized 1F8 Chagas antigen at 2-8°C. After reconstitution, store at -20°C. Prevent freeze/thaw cycles.
-
Solubility
It is recommended to reconstitute the lyophilized 1F8 Chagas protein in sterile distilled pyrogen free water at 100µg/ml, which can then be further diluted to other aqueous solutions.
-
Applications
Reacts with sera from infected patients, Useful for immunoassays.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Hepatitis B antibodyDescription:
Hepatitis B (AD & AY Antigens), Mouse antibody
Product # :
ANT-150Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- formulation
- More Info
Formulation
1mg/ml in PBS (after reconstitution).
More Info
-
Introduction
Hepatitis B is one of a few known non-retroviralviruses which employ reverse transcriptionas a part of its replication process. (HIV, a completely unrelated virus, also uses reverse transcription, but it is a retrovirus.) HBV invades the cell by binding to surface receptor and become internalized. The viral core particles then migrate to the hepatocyte nucleus and the partially double-stranded, relaxed circular genomes (RC-DNA) are repaired to form a covalently closed circular DNA (cccDNA), which is the template for viral genomic and sub-genomic RNAs by cellular RNA polymerase II. Of these, the pregenomic RNA (pgRNA is selectively packaged into progeny capsids and is then reverse-transcribed into new RC-DNA. The core can either bud into the endoplasmic reticulum to be enveloped or exported from the cell or recycled back into the genome for conversion to cccDNA.
-
Solubility
Reconstitute with H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
-
Immunogen
r.Hep B vaccine (BTG) .
-
Ig Subclass
mouse IgG1.
-
Clone
NYRHepB.
-
Note
This antibody recognizes both the AD and the AY antigens in direct ELISA.
-
Titer
By direct ELISA, 1:5,000 dilution will yield 0.2 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories).
-
Shipping Conditions
Antibody is shipped lyophilized at ambient temperature.
-
Type
Mouse antibody Monoclonal.
-
Storage Procedures
In lyophilized form, for long periods, store at 4oC in a dry environment. After reconstitution, if not intended for use within a month, aliquot and store at -20oC.
-
Purification Method
Ion exchange column.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
T.pallidum TmpA partialDescription:
Treponema pallidum TmpA (partial) Recombinant
Product # :
TRP-245Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived 68kDa recombinant protein contains the Trp. Pallidum TmpA immunodominant regions, 23-41 amino acids and 288-325 amino acids.
Source
Escherichia Coli.
Formulation
10mM Tris-HCl pH8.0, 20mM DDT, 1mM EDTA and 8M urea.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Treponema pallidum is a gram-negative spirochaete bacterium and is considered to be metabolically crippled. There are at least four known subspecies: T. pallidum pallidum, T. pallidum pertenue, T. pallidum carateum and T. pallidum endemicum. The helical structure of T. pallidum pallidum allows it to move in a corkscrew motion through viscous mediums such as mucus. Treponema pallidum sub sp. pallidum has one of the smallest bacterial genomes at 1.14 million base pairs (Mb) and has limited metabolic capabilities, reflecting its adaptation through genome reduction to the rich environment of mammalian tissue.
-
Stability
T.pallidum TmpA partial although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
This protein binds to murine anti-TmpA protein monoclonal antibodies and Treponema pallidum converted human serum polyclonal antibodies in ELISA and Western Elisa. Dot Blots and Lateral Flow immunochromatographic diagnostics test.
-
Specificity
Immunoreactive with sera of Trp. Pallidum infected individuals.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV Genotype 1b, 170 a.a.Description:
Hepatitis C Virus Nucleocapsid (core) Genotype-1b, 170 a.a Recombinant
Product # :
HCV-007Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant HCV Core genotype 1b produced in E.Coli containing 170 amino acids and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Sterile filtered solution containing 1x PBS and 25mM Arginine.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSSTNPKPQRKTKRNTNRRPQDV
KFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGWRQPIPKARRPEGRAW
AQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGF
ADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPVDKLAAALEHHHHHH*
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue Envelope-2 & 4Description:
Dengue Virus Subtype 2 & 4 fused Envelope 52kDa Recombinant
Product # :
DEN-026Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant 52kDa protein is genetically engineered peptide which is derived from Dengue Type-2 and 4 to be expressed as a fused envelope, each part in this fusion contains 170 a.a (positions 46-217),it is used in ELISA assay. This fusion protein is connected to a 6xHis Tag. Dengue Type-2 and 4 is purified by proprietary chromatographic technique.
Source
Escherichia Coli.
Formulation
The protein solution contains Phosphate buffered saline, pH-7.4 and 0.05% sodium azide.
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Dengue Envelope-2 & 4 Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HBXIP HumanDescription:
Hepatitis B Virus x Interacting Protein Human Recombinant
Ragulator complex protein LAMTOR5, Hepatitis B virus X-interacting protein, HBV X-interacting protein, HBX-interacting protein, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5, LAMTOR5, HBXIP, XIP.
Product # :
HBV-235Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HBXIP Human Recombinant produced in E. coli is a single polypeptide chain containing 197 amino acids (aa 1-173) and having a molecular mass of 20.7kDa.HBXIP is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The HBXIP solution (1mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.1M NaCl, 10% glycerol and 1mM EDTA.
Purity
Greater than 90% as determined by SDS-PAGE.
More Info
-
Introduction
Hepatitis B virus x interacting protein (HBXIP) forms a complex with the C-terminus of hepatitis B virus X (HBX) protein. HBXIP negatively regulates HBX activity and changes the replicative life cycle of the virus. Furthermore, HBXIP is involved in bipolar spindle formation and regulates centrosome dynamics and cytokinesis in cells, possibly due to interaction with Dynein light chain. HBXIP is highly expressed in the skeletal and cardiac muscle, followed by pancreas, kidney, liver, brain, placenta and lung. HBXIP has elevated levels in both cancerous and non-cancerous liver tissue of patients with chronic HBV infection compared with hepatic tissue without HBV infection.
-
Synonyms
Ragulator complex protein LAMTOR5, Hepatitis B virus X-interacting protein, HBV X-interacting protein, HBX-interacting protein, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5, LAMTOR5, HBXIP, XIP.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MGSHMEPGAG HLDGHRAGSP SLRQALCDGS AVMFSSKERG RCTVINFVPL EAPLRSTPRS RQVTEACGGE GRAVPLGSEP EWSVGGMEAT LEQHLEDTMK NPSIVGVLCT DSQGLNLGCR GTLSDEHAGV ISVLAQQAAK LTSDPTDIPV VCLESDNGNI MIQKHDGITV AVHKMAS.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 PanamaDescription:
H3N2 Influenza-A Virus Panama/2007/99
Product # :
IHA-006Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza A virus, strain A/Panama/2007/99. The Influenza Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The H3N2 A/Panama/2007/99 solution contains STE, 0.09% sodium azide (NaN3) and 0.005% thimerosal.
Stir thoroughly prior to its use.Purity
Greater than 90.0% as determined byAnalysis by SDS-PAGE.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2 by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2 and H3N2 strains contained genes from avian influenza viruses.
-
Physical Appearance
Opaque suspension.
-
Stability
A/Panama/2007/99 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatmentThis product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Tested with anti-influenza A monoclonal antibodies in ELISA.Serological studies of influenza A virus, immunogen for antibody production.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HBsAg adw2Description:
Hepatitis B Surface Antigen, adw2 Recombinant
Product # :
HBS-885Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HbsAg subtype adw2 produced in E.Coli, is a single, non-glycosylated, polypeptide chain containing 226 amino acids and having a molecular weight of approximately 23.0kDa. HBsAg adw2 migrates on SDS-PAGE as a 23kDa monomer band with minor amounts of dimer (46kDa) and trimer (69kDa) forms.The HBsAg is fused to a 6 His tag on C-terminus and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Sterile filtered solution containing 50mM potassium phosphate.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
HBsAg is the surface antigenof the Hepatitis-B-Virus (HBV). The capsidof a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH
SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP
CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV
QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Anhui H7N9Description:
Hemagglutinin-Influenza A Virus H7N9 Anhui 2013 Recombinant
Hemagglutinin, Influenza A virus (A/Anhui/1-BALF_RG45/2013(H7N9) hemagglutinin, HA, Hemagglutinin HA1 chain, Hemagglutinin HA2 chain
Product # :
IHA-037Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Anhui H7N9 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 330 amino acids (19-339 aa) and having a molecular mass of 36 kDa.Anhui H7N9 is fused to a 6 amino acid His tag at C-terminus and purified by proprietary chromatographic techniques.
Source
Sf9, Baculovirus cells.
Formulation
The Anhui H7N9 solution (1mg/ml) contains 10% Glycerol and Phosphate-Buffered Saline (pH 7.4).
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Hemagglutinin-Influenza A Virus H7N9 Anhui 2013 (Anhui H7N9) is a part of the influenza viruses hemagglutinin family. H7N9 Anhui is anantigenic glycoprotein which is responsible for binding the virus to the infected cell. An H7N9 virus was firstreported to have infected humans in March 2013, in China. Although the risk is low, The H7N9 virus has thegreatest potential compared with other influenza A viruses to cause a pandemicbecause like other type A viruses, it is not easily transmitted between people in its current form.
-
Synonyms
Hemagglutinin, Influenza A virus (A/Anhui/1-BALF_RG45/2013(H7N9) hemagglutinin, HA, Hemagglutinin HA1 chain, Hemagglutinin HA2 chain
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
ADLDKICLGH HAVSNGTKVN TLTERGVEVV NATETVERTN IPRICSKGKR TVDLGQCGLL GTITGPPQCD QFLEFSADLI IERREGSDVC YPGKFVNEEA LRQILRESGG IDKEAMGFTY SGIRTNGATS ACRRSGSSFY AEMKWLLSNT DNAAFPQMTK SYKNTRKSPA LIVWGIHHSV STAEQTKLYG SGNKLVTVGS SNYQQSFVPS PGARPQVNGL SGRIDFHWLM LNPNDTVTFS FNGAFIAPDR ASFLRGKSMG IQSGVQVDAN CEGDCYHSGG TIISNLPFQN IDSRAVGKCP RYVKQRSLLL ATGMKNVPEI PKGRHHHHHH
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Malaria Pf. MSP1Description:
Malaria Falciparum MSP1 Recombinant
Product # :
MAL-004Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Merozoite surface antigen is a protein located on the outside of the merozoite, playing an imperative role in immune reaction. About 55% cases of malaria are infected by Plasmodium falciparum (Pf). Pf MSP1 has to be used with Plasmodium vivax (Pv) together for ELISA and rapid diagnostic test, Plasmodium falciparum and vivax infection takes about 95% of Plasmodium caused infection. Recombinant Malaria Falciparum MSP1 produced in E.coli, is a 62kDa protein fused to a GST tag at N-terminus and purified by proprietary chromatographic technique.
Formulation
Sterile Filtered solution containing PBS and 25mM K2CO3.
Purity
Protein is >90% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Plasmodium falciparum is a protozoan parasite, one of the species of Plasmodium that cause malaria. Malaria parasites are members of the Apicomplexa. Apicomplexa are characterized by a set of organelles found in some stages of the parasite's life cycle. These organelles, collectively known as apical organelles because of their localization at one end of the parasite, are involved in interactions between the parasite and host. In particular, the apical organelles have been implicated in the process of host cell invasion. In the case of Plasmodium, three distinct invasive forms have been identified: sporozoite, merozoite, and ookinete.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Pf. MSP1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
Rapid test and Immunoassay.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Yellow Fever VirusDescription:
Yellow Fever Virus Recombinant
Product # :
YFV-001Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Yellow Fever Virus produced in E. coli migrates at 12kDa.Recombinant Yellow Fever Virus is fused to a 6xHis tag at its C-terminus and purified by proprietary chromatographic technique.
Source
Escherichia Coli.
Formulation
Recombinant Yellow Fever Virus protein solution contains PBS, 25mM K2CO3.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Yellow fever virus is a part of Flaviviridaeis virus family. Yellow Fever Virusis a 40–50nm enveloped RNA virus, transmitted by mosquitoe. Recombinant yellow fever virus protein is derived from its envelope domain III.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Upon arrival, Store at -20°C. Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Influenza B AntibodyDescription:
Influenza-B Jiangsu/10/2003 Hemagglutinin, Rabbit Antibody
Product # :
ANT-256Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Influenza Hemagglutinin protein is an envelope glycoprotein responsible for binding to sialic receptors and influenza viral entry into host cells. The antibody was produced by immunization of rabbits with purified recombinant influenza B Jiangsu/10/2003 Virus produced in insect cells using baculovirus expression vector system. The antigen was purified under conditions that preserve the HA proteins biological activity and tertiary structure.
Formulation
PBS pH 7.0, 0.005% Sodium Azide & 50% glycerol.
Purity
90%.
More Info
-
Introduction
Influenza-B virus is a genus in the virus family Orthomyxoviridae. The only species in this genus is called "Influenza B virus". Influenza B virus only infects humans and seals. This limited host range is apparently in contrast with those caused by the similar Influenza virus A as both mutate by both genetic drift and reassortment. Influenza-B virus evolves slower than A viruses and faster than C viruses. Influenza-B virus mutates at a rate 2-3 times lower than type A. However, influenza B mutates enough that lasting immunity is not possible. The Influenza B virus capsid is enveloped while its virion consists of a matrix protein + envelope + nucleoprotein complex + nucleocapsid, and a polymerase complex. Influenza B is sometimes spherical and sometimes filamentous. Its 500 or so surface projections are made of hemagglutinin and neuraminidase.
The Influenza B virus is 14648 nucleotides long and consists of eight segments of linear negative-sense, single-stranded RNA. The multipartite genome is encapsidated, each segment in a separate nucleocapsid, and the nucleocapsids are surrounded by one envelope. -
Immunogen
Recombinant Influenza B Jiangsu/10/2003.
-
Applications
Influenza B haemagglutinin Western Blotting at a concentration of 0.5µg/ml. ELISA to be determined.
-
Shipping Conditions
Antibody is shipped in liquid form with ice packs.
-
Type
Rabbit Antibody Polyclonal.
-
Storage Procedures
Store at -20°C.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 WyomingDescription:
H3N2 Influenza-A Virus Wyoming/3/2003 Recombinant
Product # :
IHA-012Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H3N2 A/Wyoming/2003/3 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells and its Mw is 72,000 Dalton. Accession number: AY531033.
Source
Baculovirus Insect Cells
Formulation
The Recombinant H3N2 A/Wyoming/2003/3 solution contains 10mM Sodium phosphate, pH 7.4, 150mM NaCl and 0.005% Tween-20.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2and H3N2 strains contained genesfrom avian influenzaviruses.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
H3N2 A/Wyoming/2003/3 Recombinant should be stored at 4°C.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue NS1 ST4, InsectDescription:
Dengue Virus NS1 Subtype 4 Recombinant, Insect Cells
Product # :
DEN-032Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Dengue Virus NS1 Subtype 4 produced in Insect Cells is a polypeptide chain containing amino acids 776-1130 and having a molecular weight of approximately 50kDa. Dengue NS1 ST4 is purified by proprietary chromatographic technique.
Source
Insect cells.
Formulation
Dengue NS1 ST4 protein solution in 1xD-PBS, pH7.4, 0.1% Thimerosal, 5mM EDTA, 1?g/ml of Leupeptin, Aprotinin and Pepstatin A.
Purity
Protein is >95% pure as determined by 12.5% SDS-PAGE.
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.