Search results
1000 results found for “Myxovirus”
Name
Description
Product #
Price
Quantity
Shipping Method
- View Data Sheet
Name :
VZV gEDescription:
Varicella Zoster Virus gE Recombinant
Product # :
VZV-231Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the VZV gE immunodominant regions, amino acids 48-135 and fused to a GST-Tag at N-terminus.
Formulation
60mM NaCl, 50mM Tris-HCl pH 8.0, 0.25% Sarkosil, 10mM glutathione and 50% glycerol.
Purity
Varicella protein is >90% pure as determined by SDS-PAGE.
More Info
-
Introduction
VZV is closely related to the herpes simplex viruses(HSV), sharing much genomehomology. The known envelope glycoproteins (gB, gC, gE, gH, gI, gK, gL) correspond with those in HSV, however there is no equivalent of HSV gD. VZV virons are spherical and 150-200 nm in diameter. Their lipidenvelope encloses the nucleocapsid of 162 capsomeres arranged in a hexagonalform. Its DNAis a single, linear, double-stranded molecule, 125,000 nt long. The virus is very susceptible to disinfectants, notably sodium hypochlorite. Within the body it can be treated by a number of drugs and therapeutic agents including aciclovir, zoster-immune globulin(ZIG), and vidarabine.
-
Stability
Varicella Protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Specificity
Immunoreactive with sera of VZV-infected individuals.
-
Purification Method
Varicella was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Description:
Mouse Anti Norovirus Group-I Paired
Product # :
ANT-662Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Paired Norovirus Group-I antibodies, capture and conjugating, target the viral nuclear protein. They were developed to detect Norovirus I antigen in stool rapid test. The capture antibody is used as a coating antibody, and the conjugating antibody is used as the conjugate to bind to colloid gold. Please note that when ordering for example: 100µg antibody we ship 50µg from each of the antibodies (100µg in total).
Formulation
* Norovirus Group I capture antibody in 1xPBS, pH 7.4.
* Norovirus Group I conjugating antibody in 1xPBS, pH 7.4.Purity
Greater than 95%.
More Info
-
Introduction
Noroviruses are categorized into two groups - group 1 and group 2. Norovirus is a widespread virus which can cause human gastroenteritis, an illness characterized with symptoms such as abdominal pain, diarrhea, vomiting and sickness. In America there are about 20 million causes of infection by Nororvirus, 800 ending in deaths. Worldwide, this virus infects around 267 million people and causes over 200,000 deaths per year. Even though having norovirus is unpleasant, it is seldom dangerous and typically ends in full recovery after few days. The cases resulting in deaths are primarily very young, elderly and immuno-suppressed individuals and people from less developed countries. Norovirus is extremely contagious and is spread from person to person, by infected food or water or polluted surfaces. Outbreaks usually happen from November to April, peaking in January.
-
Physical Appearance
2 vials of sterile filtered clear colorless solution.
-
Stability
Norovirus Group I antibody although stable at 4°C for 1 week, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
-
Applications
Lateral flow immunoassay.
-
Type
Mouse antibody Monoclonal.
-
Purification Method
Purified monoclonal IgG by protein A chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Rubella Virus CapsidDescription:
Rubella Virus Capsid Recombinant
Product # :
RUB-294Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant Rubella Virus Capsid is a 35kDa protein which is fused to a His tag in N-terminus.
Source
Escherichia Coli.
Formulation
25mM K2CO3 and PBS.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Rubella Virus Capsid although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Background
The Rubella Capsid Protein is responsible for encapsidating the viral RNA genome, forming the nucleocapsid structure, which is crucial for viral assembly and replication. Studies using recombinant capsid protein have demonstrated its ability to self-assemble into virus-like particles (VLPs), which mimic the native structure of the virus and are valuable for studying viral assembly. The capsid protein is a major target of the host immune response during rubella infection. Recombinant Rubella Capsid Protein has been used to investigate the humoral and cellular immune responses it elicits. Understanding these immune responses is critical for improving vaccine design and developing diagnostic assays to detect rubella-specific antibodies.
-
Specificity
Immunoassay.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
M CSF Human, BaculovirusDescription:
Macrophage Colony Stimulating Factor Human Recombinant, Baculovirus
CSF-1, Lanimostim, MCSF, MGC31930, M-CSF, Macrophage colony-stimulating factor 1, CSF1.
Product # :
CYT-637Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- description
- source
- formulation
- purity
- biological activity
- More Info
Description
Macrophage Colony Stimulating Factor Human Recombinant produced in Baculovirus is a disulfide linked homodimer, glycosylated, polypeptide chain containing 2 x 149 amino acids and having a total molecular mass of 42 kDa.MCSF is purified by proprietary chromatographic techniques.
Source
Baculovirus infected Silkworm.
Formulation
The lyophilized protein (1mg/ml) was lyophilized with 20mM phosphate buffer, 1% HSA and 3% manntiol.
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.Biological Activity
The ED50, calculated by the dose-dependant stimulation of the proliferation of murine M-NFS-60 indicator cells was found < 3ng/ml, corresponding to a specific activity of less than 333,333.33units/mg.More Info
-
Introduction
Granulocyte/Macrophage Colony-Stimulating Factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.
-
Synonyms
CSF-1, Lanimostim, MCSF, MGC31930, M-CSF, Macrophage colony-stimulating factor 1, CSF1.
-
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
-
Stability
Lyophilized Macrophage Colony Stimulating Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCSF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
-
Solubility
It is recommended to reconstitute the lyophilized M-CSF in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
-
Amino Acid Sequence
EEVSEYCSHM IGSGHLQSLQ RLIDSQMETS CQITFEFVDQ EQLKDPVCYL KKAFLLVQDI MEDTMRFRDN TPNAIAIVQL QELSLRLKSC FTKDYEEHDK ACVRTFYETP LQLLEKVKNV FNETKNLLDK DWNIFSKNCN NSFAECSSQ.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Monkeypox A33RDescription:
Monkeypox A33R Recombinant
Product # :
MPV-001Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant A33R protein contains the Envelope Monkeypox immunodominant regions, having an Mw of 23kDa. The Monkeypox protein is fused to a 6xHis tag at C-terminus and purified by proprietary chromatographic technique
Source
Escherichia Coli.
Formulation
Recombinant Monkeypox protein solution contains PBS, 0.05% sodium nitrate and 25mM K2CO3
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Monkeypox virus is transmitted to humans from animalssuch as rodents and primates having similar symptoms similar of smallpox although less severe. Monkeypox is an enveloped double-stranded DNA virus approximately 190 kb which is part of the Orthopoxvirus genus of the Poxviridae family. 2monkeypox genetic clades: central African which is more transmissible& west African clade. Monkeypox virus spreadsfrom animal to human &human to humanvia animal bite or by direct body fluid contact. Incubation period lasts12 days. The MPV common ssymptoms include fever, rash, headache, swelling of lymph nodes and muscle pain,
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Upon arrival, Store at -20°C. Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Parvovirus B19 VLP VP1Description:
Parvovirus VLP VP1 Recombinant
Product # :
PRV-003Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Parvovirus B19 VLP VP1 produced in e.coli contains 227 amino acids from the N-terminus of VP1 protein sequence.Parvovirus B19 VLP VP1/VP2 is purified by proprietary chromatographic techniques.
Source
e.coli.
Formulation
Parvovirus B19 VLP VP1 protein solution is supplied in PBS and 25mM K2CO3.
Purity
Greater than 90.0% as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
The B19 virus, usually referred to as parvovirus B19 or sometimes as erythrovirus B19, belongs to the family of parvoviruses, genus erythrovirus. B19 virus causes a childhood rash named “fifth disease” or “erythema infectiosum” which is ordinarily known as “slapped cheek syndrome”. Erythroviruses are members of the Parvoviridae family of small DNA viruses. The B19 virus is a non-enveloped, icosahedral virus which contains a single-stranded linear DNA genome. Parvovirus B19 is classified as erythrovirus because of its capability to invade red blood cell precursors in the bone marrow. This virus is mainly spread by infected respiratory droplets; though, blood-borne transmission has also been reported.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 WisconsinDescription:
H3N2 Influenza Virus-A Wisconsin/67/05 Recombinant
Product # :
IHA-020Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H3N2 A/Wisconsin/67/05 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells and its Mw is 72,000 dalton.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H3N2 A/Wisconsin/67/05 solution contains 10mM Sodium phosphate, pH 7.2 and 150mM Sodium Chloride.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2 by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2and H3N2 strains contained genesfrom avian influenzaviruses.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
H3N2 A/Wisconsin/67/05 Recombinant should be stored at 4°C.Do not freeze!
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
M.Pneumoniae P116Description:
Mycoplasma Pneumoniae P116 Recombinant
Product # :
PRO-513Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The Recombinant Mycoplasma Pneumoniae P116 was expressed in E. coli having an Mw of 116 kDa. P116 is fused to a His-Tag.
Source
E.Coli
Formulation
Mycoplasma Pneumoniae P116 is formulated in 1xPBS, pH 7.4 and 25mM arginine.
Purity
Greater than 95% as determined by 10% PAGE (Coomassie staining).
More Info
-
Introduction
Mycoplasma pneumonia is part of the atypical pneumonia subtype which is caused by the bacteria M. pneumoniae. Mycoplasma pneumonia affects individuals younger than 40. It makes up 15 - 50% of all pneumonia cases in adults and especially in school-aged children. People at great risk for mycoplasma pneumonia comprise of those living or working in busy areas such as schools and homeless shelters, although many people who contract mycoplasma pneumonia have no identifiable risk factor. P1, P30, and P116 of mycoplasma pneumonia membrane proteins have been recognized as adhensive factors, P1 is considered as a main adhension protein of the organism colonization.
-
Physical Appearance
Streile filtered colorless solution.
-
Stability
Upon arrival, Store at -20°C.Please prevent freeze-thaw cycles.
-
Applications
Immunoassay.
-
Purification Method
The recombinant fusion protein was purified by GSH affinity chromatography technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 KievDescription:
H3N2 Influenza-A Virus Kiev/301/94
Product # :
IHA-005Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza A virus, strain A/Kiev/301/94 like /Johannesburg/33/94. The Influenza Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The H3N2 A/Kiev/301/94 solution contains 0.1M NaCl, 10mM Tris-Hcl, 1mM EDTA pH-8, 0.1% sodium azide (NaN3) and 0.005% thimerosal.
Purity
Greater than 90.0% as determined byAnalysis by SDS-PAGE.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2and H3N2 strains contained genesfrom avian influenzaviruses.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
A/Kiev/301/94 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatment.This product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Serological studies of influenza A virus, immunogen for antibody production.Tested with anti-influenza A monoclonal antibodies in ELISA.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
M.Pneumoniae P30Description:
Mycoplasma Pneumoniae P30 Recombinant
Product # :
PRO-2738Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
M.Pneumoniae P30 Recombinant produced in E.Coli is a non-glycosylated polypeptide chain having a molecular mass of 18-19kDa.M.Pneumoniae P30 is fused to a 6 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
MP-P30c solution contains 25mM K2CO3, 0.025% NaN3 and PBS.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
Mycoplasma pneumonia is part of the atypical pneumonia subtype which is caused by the bacteria M. pneumoniae. Mycoplasma pneumonia affects individuals younger than 40. It makes up 15 - 50% of all pneumonia cases in adults and especially in school-aged children. People at great risk for mycoplasma pneumonia comprise of those living or working in busy areas such as schools and homeless shelters, although many people who contract mycoplasma pneumonia have no identifiable risk factor. P1, P30, and P116 of mycoplasma pneumonia membrane proteins have been recognized as adhesive factors, P1 is considered as a main adhesion protein of the organism colonization.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
The Recombinant MP-P30c protein although stable at 4°C for 1 week, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
-
Applications
Immunoassay.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 Hong Kong RecombinantDescription:
H3N2 Influenza A- Virus Hong Kong 4801/2014 Recombinant
Product # :
IHA-043Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H3N2 Hong Kong 4801/2014 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H3N2 A/ Hong Kong 4801/2014 solution contains 10mM Sodium phosphate, pH 7.4,150mM NaCl and 0.005% Tween-20.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2 by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2and H3N2 strains contained genesfrom avian influenzaviruses.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
H3N2 A/ Hong Kong 4801/2014 recombinant should be stored at 4°C. Do not freeze!
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 PanamaDescription:
H3N2 Influenza-A Virus Panama/2007/99
Product # :
IHA-006Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza A virus, strain A/Panama/2007/99. The Influenza Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The H3N2 A/Panama/2007/99 solution contains STE, 0.09% sodium azide (NaN3) and 0.005% thimerosal.
Stir thoroughly prior to its use.Purity
Greater than 90.0% as determined byAnalysis by SDS-PAGE.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2 by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2 and H3N2 strains contained genes from avian influenza viruses.
-
Physical Appearance
Opaque suspension.
-
Stability
A/Panama/2007/99 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatmentThis product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Tested with anti-influenza A monoclonal antibodies in ELISA.Serological studies of influenza A virus, immunogen for antibody production.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H9N2 Hong-KongDescription:
H9N2 Influenza-A Virus Hong-Kong/1073/99 Recombinant
Product # :
IHA-013Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H9N2 A/Hong-Kong/1073/99 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells and its Mw is 72,000 dalton. The accession number is AJ404626.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H9N2 A/Hong-Kong/1073/99 solution contains 10mM Sodium Phosphate, pH 7.0 and 150mM NaCl and 0.01% Tween-20.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H9N2 is a subtype of the species Influenza A virus, whereas the PB1 and PB2 genes are closely related to those of the H5N1viruses and a quailH9N2 virus A/quail/Hong Kong/G1/97 (Qa/HK/G1/97) suggesting that many of the 1997chicken H9 isolates in the markets were reassortants.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
A/H9N2 Hong-Kong/1073/99 Recombinant should be stored at 4°C.
-
Immunological Activity
Western-Blot 0.1µg -1µg per strip, ELISA 1µg/Well.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CMV Pp150Description:
Cytomegalo Virus Pp150 (UL32) Recombinant
Product # :
CMV-216Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the CMV Pp150 (UL32) immunodominant regions, 1011-1048 amino acids.
Source
Escherichia Coli.
Formulation
50mM Tris pH 8.0, 1mM EDTA and 50% glycerol.
Purity
CMV Pp150 protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
CMV belongs to the Betaherpesvirinae subfamily of Herpesviridae which includes herpes simplex virustypes 1 and 2, varicella-zoster virus, and Epstein-Barrvirus. The herpesviruses share a characteristic ability to remain latentover long periods. CMV is a double-stranded linear DNA virus with 162 hexagonal protein capsomeres surrounded by a lipid membrane. CMV has the largest genome of the herpes viruses, ranging from 230-240 kilobase pairs. Human CMV is composed of unique and inverted repeats that include the existence of 4 genome isomers caused by inversion of L-S genome components (class E). Replication may be divided into immediate early, delayed early, and late gene expression based on time of synthesis after infection. The DNA is replicated by rolling circles. In vitro, CMV replicates in human fibroblasts.
-
Stability
CMV Pp150 protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
CMV Pp65 antigen is suitable for ELISA and Western blots, excellent antigen for detection of CMV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of CMV-infected individuals.
-
Purification Method
CMV Pp150 was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Monkeypox B5RDescription:
Monkeypox B5R Recombinant
Product # :
MPV-002Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant B5R protein contains the Envelope Monkeypox immunodominant regions, having an Mw of 32kDa. The Monkeypox protein is fused to a 6xHis tag at C-terminus and purified by proprietary chromatographic technique
Source
Escherichia Coli.
Formulation
Recombinant Monkeypox protein solution contains PBS, 0.05% sodium nitrate and 25mM K2CO3
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
Monkeypox virus is transmitted to humans from animalssuch as rodents and primates having similar symptoms similar of smallpox although less severe. Monkeypox is an enveloped double-stranded DNA virus approximately 190 kb which is part of the Orthopoxvirus genus of the Poxviridae family. 2monkeypox genetic clades: central African which is more transmissible& west African clade. Monkeypox virus spreadsfrom animal to human &human to humanvia animal bite or by direct body fluid contact. Incubation period lasts12 days. The MPV common ssymptoms include fever, rash, headache, swelling of lymph nodes and muscle pain,
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Upon arrival, Store at -20°C. Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CMV Pp28Description:
Cytomegalo Virus Pp28 (UL99) Recombinant
Product # :
CMV-212Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the CMV Pp28 (UL99) immunodominant regions, 130-160 amino acids.
Source
Escherichia Coli.
Formulation
50mM Tris-Hcl pH 7.2, 1mM EDTA and 50% glycerol.
Purity
CMV Pp28 protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
The human cytomegalovirus UL99-encoded pp28 is a myristylated phosphoprotein that is a constituent of the virion. The pp28 protein is positioned within the tegument of the virus particle, a protein structure that resides between the capsid and envelope. In the infected cell, pp28 is found in a cytoplasmic compartment derived from the Golgi apparatus, where the virus buds into vesicles to acquire its final membrane.
-
Stability
CMV Pp28 protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
CMV Pp28 antigen is suitable for ELISA and Western blots, excellent antigen for detection of CMV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of CMV-infected individuals.
-
Purification Method
Purified by GS-4B Sepharose-Affinity Purification.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H7N7 NetherlandsDescription:
H7N7 Influenza-A Virus Netherlands/219/03 Recombinant
Product # :
IHA-009Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H7N7 A/Netherlands/219/03 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells and its Mw is approximately 70,000 Dalton.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H7N7 A/Netherlands/219/03 solution contains 10mM Sodium phosphate, pH 7 and 150mM NaCl.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
H7N7 A/Netherlands/219/03 Recombinant should be stored at 4°C.
-
Immunological Activity
Western-Blot 0.1µg -1µg per strip, ELISA 1µg/Well.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Monkeypox A27Description:
Monkeypox A27 Recombinant
Product # :
MPV-003Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant Monkeypox A27 (a.a. 1-203) having a Mw of 24881.35 Dalton. The protein is fused to a 6xHis tag at C-terminus.
Source
Escherichia Coli.
Formulation
1XPBS.
Purity
Protein is >90% pure as determined by SDS-PAGE.
More Info
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Monkeypox A27 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Background
MPV, monkeypox virus is a double stranded dna having an outer lipoprotein membrane that infects humans and animals and leads to a Mpox disease.
The disease monkeypox name results from the isolation of the virus from monkeys though most carriers are other animals.
Fever, rash, blisters and swollen lymph nodes are symptoms of the MPXV.
When the Mpox vaccine is given 4 years prior to the infection the human or animal will not be infected with the mpvx.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H1N1 New CaledoniaDescription:
H1N1 Influenza-A Virus New Caledonia/20/99 IVR 116
Product # :
IHA-003Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza A virus, strain A/ New Caledonia/20/99 IVR 116. The Influenza Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The H1N1 A/New Caledonia/20/99 IVR solution contains STE, 0.09% sodium azide (NaN3) and 0.005% thimerosal.
Purity
Greater than 90.0% as determined by ELISA analysis.
More Info
-
Introduction
H1N1 is a subtype specie of Influenza A virus. H1N1 Influenza Virus has mutated into various strains such as the Spanish Flustrain, mild humanflu strains, endemic pigstrains, and various strains found in birds. The Influenza A Virus is a globular particle about 100nm in diameter, sheathed in a lipid bilayer derived from the plasma membrane of its host. Studded in the lipid bilayer are two integral membrane proteins some 500 molecules of hemagglutinin ("H") and some 100 molecules of neuraminidase ("N"). Within the lipid bilayer are 3000 molecules of matrix protein and 8 pieces of RNA. Each of the 8 RNA molecules is associated with many copies of a nucleoprotein, several molecules of the three subunits of its RNA polymerase some "non-structural" protein molecules of uncertain function.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
A/New Caledonia/20/99 IVR although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatmentThis product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Tested with anti-influenza A monoclonal antibodies in ELISA.Serological studies of influenza A virus, immunogen for antibody production.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H1N1 Solomon IslandsDescription:
H1N1 Influenza-A Virus Solomon Islands/03/06 Recombinant
Product # :
IHA-031Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Full-Length H1N1 A/Solomon Islands/03/2006 is glycosylated with N-linked sugars, produced using baculovirus vectors in insect cells.
Source
Baculovirus Insect Cells.
Formulation
The Recombinant H1N1 A/Solomon Islands/03/2006 solution contains 10mM Sodium phosphate, pH 7.1,150mM NaCl and 0.005% Tween-20.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H1N1 is a subtype specie of Influenza A virus. H1N1 Influenza Virus has mutated into various strains such as the Spanish Flu strain, mild human flu strains, endemic pigstrains, and various strains found in birds. The Influenza A Virus is a globular particle about 100nm in diameter, sheathed in a lipid bilayer derived from the plasma membrane of its host. Studded in the lipid bilayer are two integral membrane proteins some 500 molecules of hemagglutinin ("H") and some 100 molecules of neuraminidase ("N"). Within the lipid bilayer are 3000 molecules of matrix protein and 8 pieces of RNA. Each of the 8 RNA molecules is associated with many copies of a nucleoprotein, several molecules of the three subunits of its RNA polymerase some "non-structural" protein molecules of uncertain function.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
H1N1 A/Solomon Islands/03/2006 Recombinant should be stored at 4°C.
-
Immunological Activity
Western-Blot 0.1µg -1µg per strip, ELISA 1µg/Well.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HTLV-1 mosaicDescription:
HTLV-1 Mosaic Recombinant
Product # :
HIV-144Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant mosiac protein contains the gp21 and gp46 immunodominant regions, 374-400 amino acids and 190-201 amino acids. The protein is fused with GST at N-terminus.
Formulation
20mM Phosphate buffer PH 7.5.
Purity
Protein is >95% pure as determined by SDS-PAGE.
More Info
-
Introduction
Human T-lymphotropic virus (HTLV) is a human, single-stranded RNA retrovirus that causes T-cell leukemia and T-cell lymphoma. The virus activates a subset of T-helper cellscalled Th1cells. The result is a proliferation of Th1 cells and overproduction of Th1 related cytokines (mainly IFN-gamma and TNF-alpha). Feedback mechanisms of these cytokines cause a suppression of the Th2 lymphocytes and a reduction of Th2 cytokine production (mainly IL-4, IL-5, IL-10 and IL-13). The end result is a reduction in the ability of the infected host to mount an adequate immune response to invading organisms that require a predominantly Th2 dependant response (these include parasitic infections and production of mucosal and humoral antibodies).
-
Stability
HTLV-1 Mosaic although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HTLV-1 Mosaic can be used as an antigen in ELISA and Western Blots. Excellent reagent for correct detection of HTLV infections, with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HTLV-I infected individuals
-
Purification Method
HTLV-1 Mosaic was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HTNVDescription:
Hantavirus Recombinant
HTNV, Hantaan Virus, Hantanvirus.
Product # :
HTV-001Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The Hantavirus nucleocapsid (N) fusion protein is expressed in E. coli and is fused to 6xHis tag. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.
Source
E.Coli
Formulation
HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.
Purity
HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Synonyms
HTNV, Hantaan Virus, Hantanvirus.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles.
-
Amino Acid Sequence
GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD
-
Background
What is the source or expression system of Hantavirus- Nucleocapsid Protein?
Escherichia Coli.What is the Purity of Hantavirus- Nucleocapsid Protein?
Hantavirus- Nucleocapsid Protein is >95% pure as determined by SDS-PAGE.Is Hantavirus- Nucleocapsid conjugated to a Tag?
Hantavirus- Nucleocapsid is fused to 6xHis.What is the Biological Activity of Hantavirus- Nucleocapsid Protein?
The biological functionality of Hantavirus- Nucleocapsid Protein will be determined in the future.
What is the endotoxin level for Hantavirus- Nucleocapsid Protein?
The endotoxin level is minimal, Hantavirus- Nucleocapsid Protein was purified using conventional chromatography techniques.What applications can Hantavirus- Nucleocapsid Protein be used in?
Hantavirus-Nucleocapsid Protein can probably be used in Immunoassay.
What is the function of the hantavirus nucleocapsid (N) protein?
The hantavirus nucleocapsid (N) protein surrounds the viral RNA binding site and protects it during viral replication and assembly.
Why is hantavirus nucleocapsid protein commonly used in ELISA assays?
The hantavirus N protein is highly immunogenic, conserved and widely expressed and induces a strong antibody response in infected individuals.
Does hantavirus N protein bind RNA?
Hantavirus N protein contains RNA-binding domains that specifically interact with viral genomic
Is the hantavirus nucleocapsid protein suitable for antibody production?
Resulting from high immunogenicity, recombinant hantavirus N protein is highly used as an immunogen for generating both polyclonal and monoclonal antibodies. -
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Toxoplasma P35Description:
Toxoplasma Gondii P35 (GRA8) Recombinant
Dense granule protein GRA8, GRA8, TGME49_254720
Product # :
TOX-269Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Toxoplasma Gondii P35 (GRA8) containing 217 amino acids was purified from E. coli.The Recombinant Toxoplasma Gondii P35 (GRA8) is fused to GST tag at its N terminal and purified by proprietary chromatographic technique.
Source
Escherichia Coli.
Formulation
Toxoplasma P35 solution contains 0.5mM EDTA, Phosphate buffered saline, pH 7.4.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
The life cycle of Toxoplasma gondii has 2 phases. The coccidia like takes place only in members of the Felidae family which makes these animals the parasite's primary host. The asexual part of the life cycle can take place in any warm-blooded animal, like other mammals (including felines) and birds. T. gondii constructing daughter scaffolds within the mother cell. In the intermediate hosts (including felines), the parasite invades cells, forming intracellular so-called parasitophorous vacuoles containing bradyzoites, the slowly replicating form of the parasit. Vacuoles form tissue cysts mainly within the muscles and brain. Since they are within cells, the host's immune system does not detect these cysts. Resistance to antibiotics varies, but the cysts are very difficult to eradicate entirely. Within these vacuoles T. gondii propagates by a series of binary fissions until the infected cell eventually bursts and tachyzoites are released. Tachyzoites are the motile, asexually reproducing form of the parasite. Unlike the bradyzoites, the free tachyzoites are usually efficiently cleared by the host's immune response, although some manage to infect cells and form bradyzoites, thus maintaining the infection. Recombinant Toxoplasma Gondii P35 (GRA8)) is an antigen used to test the specific Toxoplasma gondii antibody for the diagnosis of Toxoplasma gondii infection.
-
Synonyms
Dense granule protein GRA8, GRA8, TGME49_254720
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Applications
Immunoassay.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H5N1 Monoclonal AntibodyDescription:
H5N1/HA1, Mouse Anti Monoclonal
Product # :
ANT-073Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- formulation
- More Info
Formulation
1mg/ml containing PBS, pH-7.4, & 0.1% Sodium Azide.
More Info
-
Introduction
Influenza A virus subtype H5N1 is a subtype of the Influenza A virus. Subtype H5N1 is commonly known as avian influenza or bird flu. H5N1 may cause more than one influenza pandemicas it is expected to continue mutating in birds. The dominant strain of HPAI A (H5N1) evolved creating the Z genotype. It has also been called Asian lineage HPAI/A/H5N1 which is divided into 2 antigenic clades. "Clade 1 includes human and bird isolates from Vietnam, Thailand, and Cambodia and bird isolates from Laosand Malaysia. Clade 2 viruses were first identified in bird isolates from China, Indonesia, Japan, and South Korea before spreading westward to the Middle East, Europe, and Africa.
-
Immunogen
Anti-human H5N1/HA1, is derived from hybridization of mouse FO myeloma cells with spleen cells from BALB/c mice immunized with recombinant human H5N1/HA1, 17-338 amino acids purified from Baculovirus.
-
Ig Subclass
Mouse IgG1 heavy chain and k light chain.
-
Clone
PAT2B7AT
-
Applications
Influenza-A H5N1 antibody has been tested by ELISA, Western blot analysis to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. Recommended dilution range for Western blot analysis is 1:3000.
-
Type
Mouse Anti Monoclonal.
-
Storage Procedures
For periods up to 1 month store at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Purification Method
Influenza-A H5N1 antibody was purified from mouse ascitic fluids by protein-G affinity chromatography.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.