Search results
1000 results found for “papillomavirus”
Name
Description
Product #
Price
Quantity
Shipping Method
- View Data Sheet
Name :
HIV-1/2 RapidDescription:
HIV-1/2 Rapid Test Recombinant
Product # :
HIV-018Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HIV1 gp41 and HIV2 gp160 are used to develop sensitive and specific rapid test. Please note that when ordering for example: 100µg HIV-1/2 Rapid we ship 50µg from each of the antibodies (100µg in total).
Source
Escherichia Coli.
Formulation
* HIV1 gp41 in 25mM PBS, 25mM K2CO3 and 2M Urea.
* HIV2 gp160 in 25mM PBS, 25mM K2CO3 and 2M Urea.
Purity
Protein is >90% pure as determined by 10% PAGE (coomassie staining)
More Info
-
Physical Appearance
2 vials of sterile Filtered clear colorless solution.
-
Stability
For periods up to 1 month HIV-1/2 Rapid should be stored at 4°C, for longer periods of time, store at -20°C. Prevent freeze thaw cycles.
-
Background
The Human Immunodeficiency Virus (HIV), specifically HIV-1 and HIV-2, continues to pose significant global health challenges, necessitating constant efforts to understand the intricacies of viral replication, immune evasion, and potential therapeutic interventions. In this pursuit, Recombinant HIV-1/2 Proteins serve as indispensable tools for researchers, offering a controlled environment to dissect viral components and study their interactions with the host immune system.
This research embarks on a comprehensive exploration of Recombinant HIV-1/2 Proteins, shedding light on their structural attributes, immunogenic properties, and potential applications in antiviral drug development. By delving into the properties of these recombinant proteins, scientists aim to deepen our understanding of HIV pathogenesis and pave the way for innovative strategies in HIV treatment and prevention.
Structural Insights into Recombinant HIV-1/2 Proteins:
Recombinant HIV-1/2 Proteins, derived from various viral components such as envelope glycoproteins (gp120, gp41), reverse transcriptase, and integrase, provide a controlled system for studying the virus's structural nuances. Understanding the three-dimensional structure of these proteins is pivotal for deciphering how the virus engages with host cells, evades immune responses, and undergoes dynamic structural changes during its life cycle.
Immunogenic Properties and Vaccine Development:
The immunogenicity of Recombinant HIV-1/2 Proteins makes them invaluable in the quest for an effective HIV vaccine. These proteins, when presented to the immune system, mimic key viral components, inducing specific immune responses. Studying the immunogenic properties of these recombinant proteins aids in the design and evaluation of potential vaccine candidates, with the ultimate goal of eliciting robust and broadly neutralizing antibodies against HIV.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS5 Genotype-2bDescription:
Hepatitis C Virus NS5 Genotype-2b Recombinant
Product # :
HCV-231Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS5 Genotype 2b immunodominant regions, amino acids 2212-2313. The protein is fused to a GST tag at N-Terminus.
Source
Escherichia Coli.
Formulation
1.5M urea, 25 mM Tris-HCl, pH-8, 0.2% Triton-X & 50% Glycerol.
Purity
HCV NS5 Genotype-2b protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS5 Genotype-2b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HCV NS5 Genotype-2b antigen in ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
HCV NS5 Genotype-2b protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HIV-1 gag p17, p24Description:
HIV-1 gag p17, p24 Recombinant
Product # :
HIV-121Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
HIV-1 p17, p24 is a non-glycosylated polypeptide chain, containing sequence of HIV-1 immunodominant regions p17-p24. The protein is fused to a GST tag at N-terminus.
Source
Escherichia Coli.
Formulation
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Tween-20 & 50% Glycerol.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
-
Physical Appearance
Sterile filtered colorless clear solution.
-
Stability
HIV-1 gag p17, p24 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
HIV-1 p17, p24 antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
-
Specificity
Immunoreactive with all sera of HIV-1 infected individuals.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue NS1Description:
Dengue Virus NS1 Recombinant
Product # :
DEN-004Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the NS1 Dengue Virus full length Type-2 immunodominant regions, having an Mw of 45kDa.The dengue protein is fused to 6xHis tag at C-terminus and purified by proprietary chromatographic technique.
Source
Escherichia Coli.
Formulation
PBS and 25mM K2CO3.
Purity
Protein is >85% pure as determined by 10% SDS-PAGE (coomassie staining).
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Stability
Dengue NS1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Amino Acid Sequence
DSGCVVSWKNKELKCGSGIFITDNVHTWTEQYKFQPESPSKLASAIQKAHEEGICGIRSVTRLENLMW
KQITPELNHILSENEVKLTIMTGDIKGIMQAGKRSLQPQPTELKYSWKTWGKAKMLSTESHNQTFLID
GPETAECPNTNRAWNSLEVEDYGFGVFTTNIWLKLREKQDVFCDSKLMSAAIKDNRAVHADMGYWIES
ALNDTWKIEKASFIEVKSCHWPKSHTLWSNGVLESEMIIPKNFAGPVSQHNYRPGYHTQTAGPWHLGK
LEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLRYRGEDGCWYGMEIRPLKE
KEENLVNSLVTA -
Applications
Immunoassay.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CoV-2 N-MosaicDescription:
Coronavirus 2019 Nucleocapsid Mosaic Recombinant
Product # :
SARS-015Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused to 6xHis tag at C-terminal.
Source
Escherichia Coli.
Formulation
CoV 2019 Nucleocapsid-Mosaic Protein solution is supplied in 1x PBS.
Purity
CoV 2019 Nucleocapsid-Mosaic Protein ein is >90% pure as determined SDS-PAGE.
More Info
-
Introduction
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.
The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.
While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
CoV 2019 Nucleocapsid-Mosaic Protein is shipped on ice packs. Upon arrival, Store at -20°C.
-
Specificity
Reactivity with SARS infected individuals not tested.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS3 Genotype-1bDescription:
Hepatitis C Virus NS3 Genotype-1b Recombinant
Product # :
HCV-204Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived 26.2 kDa recombinant protein contains the HCV NS3 c33c immunodominant regions. The 252 amino acid protein is fused to 6xHis tag.
Formulation
50mM NaPO4 pH 8.3 and 10mM DTT.
Purity
HCV NS3 Genotype-1b protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS3 Genotype-1b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Amino Acid Sequence
Starts: MRDSDSQTFQ
Ends: DSVIDCNTCVT. -
Applications
HCV NS3 Genotype-1b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
H3N2 Wisconsin/67/05Description:
H3N2 Influenza-A Virus Wisconsin/67/05
Product # :
IHA-023Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza A virus, strain A/Wisconsin/67/05. The Influenza Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The H3N2 A/Wisconsin/67/05 solution contains STE, 0.1% sodium azide (NaN3) and 0.005% thimerosal.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
H3N2 is a subtype of the influenza A virus. Its name derives from the forms of the two kinds of proteinson the surface of its coat, hemagglutinin(H) and neuraminidase(N). H3N2 exchanges genes for internal proteins with other influenza subtypes. H3N2 has tended to dominate in prevalence over H1N1, H1N2, and influenza B. H3N2 strain descended from H2N2by antigenic shift, in which genes from multiple subtypes re-assorted to form a new virus. Both the H2N2and H3N2 strains contained genesfrom avian influenzaviruses.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
A/Wisconsin/67/05 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatmentThis product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Serological studies of influenza A virus, immunogen for antibody production.Tested with anti-influenza A monoclonal antibodies in ELISA.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CoV-2 N (201-419)Description:
Coronavirus 2019 Nucleocapsid (201-419 a.a.) Recombinant
Product # :
SARS-039Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant protein contains the Coronavirus 2019 C-Terminal domain nuclepocapsid ( 201-419 a,a.) fused to 6xHis tag at C-terminal and having a molecular weight of 23.9kDa.
Source
Escherichia Coli.
Formulation
CoV 2019 Nucleocapsid-c-terminal domain Protein solution is supplied in 1x PBS.
Purity
CoV 2019 Nucleocapsid-c-terminal Protein ein is >90% pure as determined SDS-PAGE.
More Info
-
Introduction
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.
The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.
While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
CoV 2019 Nucleocapsid c-terminal domain Protein is shipped on ice packs. Upon arrival, Store at -20°C.
-
Specificity
Reactivity with SARS infected individuals not tested.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
SARS EnvelopeDescription:
SARS-Associated Coronavirus Envelope Recombinant
Product # :
SARS-252Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived 34 kDa recombinant protein contains the N-terminus Enevelope protein 1-76 amino acids immunodominant regions.
Formulation
50mM Tris-HCl, 60mM NaCl, pH 8 and 50% glycerol.
Purity
SARS Envelope protein is >95% pure as determined by 10% PAGE(coomassie staining).
More Info
-
Introduction
SARS Coronavirus is an enveloped virus containing three outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein plays an important role in virus infection cycle and is the primary target of neutralizing antibodies.
-
Stability
SARS Envelope Protein is shipped at ambient temperature.Upon arrival, store at -20C.
-
Applications
SARS Envelope antigen is suitable for ELISA and Western blots, excellent antigen for detection of SARS with minimal specificity problems.
-
Specificity
SARS Envelope protein is Immunoreactive with sera of SARS-infected individuals.
-
Purification Method
SARS Envelope protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
SARS MatrixDescription:
SARS-Associated Coronavirus Matrix Recombinant
Product # :
SARS-251Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.Coli derived 30kDa recombinant protein contains the Matrix protein 182-216 amino acids immunodominant regions.
Formulation
50mM Tris-HCl, 60mM NaCl and 50% glycerol.
Purity
SARS Matrix Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
SARS Coronavirus is an enveloped virus containing three outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein plays an important role in virus infection cycle and is the primary target of neutralizing antibodies.
-
Stability
SARS Matrix protein is shipped at ambient temperature. Upon arrival, store at -20C.
-
Applications
SARS Matrix antigen can be used for ELISA and Western blots, excellent antigen for detection of SARS with minimal specificity problems.
-
Specificity
SARS Matrix protein is Immunoreactive with sera of SARS-infected individuals.
-
Purification Method
SARS Matrix protein was purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CoV-2 Membrane Env.Description:
Coronavirus 2019 Membrane Envelope, Recombinant
Product # :
SARS-033Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived recombinant fusion protein contains the Coronavirus 2019 Full-Length Membrane and Envelope proteins, Wuhan-Hu-1 strain, having a Mw of 34.2 kDa fused to His tag at C-terminal.
Source
E.Coli
Formulation
CoV-2 Membrane Envelope protein solution is supplied in 1x PBS.
Purity
Protein is >90% pure as determined SDS-PAGE.
More Info
-
Introduction
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.
The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.
While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
CoV-2 Membrane Envelope fusion Protein is shipped on ice packs. Upon arrival, Store at -20°C.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
MAVS HumanDescription:
Mitochondrial Antiviral Signaling Protein Human Recombinant
CARDIF, IPS-1, IPS1, VISA, Mitochondrial antiviral-signaling protein, MAVS, Putative NF-kappa-B-activating protein 031N, Virus-induced-signaling adapter, KIAA1271.
Product # :
PRO-1351Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
MAVS Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 536 amino acids (1-513) and having a molecular mass of 55.9 kDa. MAVS is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
The MAVS solution (0.25mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl, 10% glycerol and 1mM DTT.
Purity
Greater than 85% as determined by SDS-PAGE.
More Info
-
Introduction
Mitochondrial antiviral signaling protein (MAVS) is vital for innate immune defense against viruses. MAVS is an intermediary protein essential in the virus-triggered IFN-beta signaling pathways. MAVS is involved in activation of transcription factors that regulate expression of IFN-beta and contributes to antiviral immunity.
-
Synonyms
CARDIF, IPS-1, IPS1, VISA, Mitochondrial antiviral-signaling protein, MAVS, Putative NF-kappa-B-activating protein 031N, Virus-induced-signaling adapter, KIAA1271.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MGSMPFAEDK TYKYICRNFS NFCNVDVVEI LPYLPCLTAR DQDRLRATCT LSGNRDTLWH LFNTLQRRPG WVEYFIAALR GCELVDLADE VASVYQSYQP RTSDRPPDPL EPPSLPAERP GPPTPAAAHS IPYNSCREKE PSYPMPVQET QAPESPGENS EQALQTLSPR AIPRNPDGGP LESSSDLAAL SPLTSSGHQE QDTELGSTHT AGATSSLTPS RGPVSPSVSF QPLARSTPRA SRLPGPTGSV VSTGTSFSSS SPGLASAGAA EGKQGAESDQ AEPIICSSGA EAPANSLPSK VPTTLMPVNT VALKVPANPA SVSTVPSKLP TSSKPPGAVP SNALTNPAPS KLPINSTRAG MVPSKVPTSM VLTKVSASTV PTDGSSRNEE TPAAPTPAGA TGGSSAWLDS SSENRGLGSE LSKPGVLASQ VDSPFSGCFE DLAISASTSL GMGPCHGPEE NEYKSEGTFG IHVAENPSIQ LLEGNPGPPA DPDGGPRPQA DRKFQEREVP CHRPSP.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV 8th GenerationDescription:
Hepatitis C Virus 8th Generation Recombinant
Product # :
HCV-273Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.Coli derived HCV Eighth generation antigen recombinant mosaic fusion protein contains multiple gene including env – core - NS3 - NS4 – NS5 and covers genotype I, II and III. The protein size is about 80kDa with GST tag at N-terminal
Source
Escherichia Coli.
Formulation
HCV 8th generation protein 1mg/ml solution contains PBS, 25mM K2CO3 and 3M urea
Purity
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus belongs to the Flaviviridae family. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes (1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). Hepatitis C Virus 8th Generationis a mosaic fusion protein which contains multiple genecassettes including env – core - NS3 - NS4 – NS5 and covers genotype I, II and III.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HCV NS4 Mosaic Genotype-1Description:
Hepatitis C Virus NS4 Mosaic Genotype-1 Recombinant
Product # :
HCV-257Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1691-1710, 1712-1733 & 1921-1940, fused with a GST tag at N-terminus.
Formulation
1.5M urea, 25mM Tris-HCl, pH 8.0, 0.2% Triton-X & 50% glycerol.
Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
More Info
-
Introduction
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). -
Stability
HCV NS4 Mosaic Genotype-1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
-
Applications
ELISA, Western blots and Flow-through.
-
Specificity
Immunoreactive with sera of HCV-infected individuals.
-
Purification Method
Purified by proprietary chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Dengue NS1 ST4, InsectDescription:
Dengue Virus NS1 Subtype 4 Recombinant, Insect Cells
Product # :
DEN-032Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Dengue Virus NS1 Subtype 4 produced in Insect Cells is a polypeptide chain containing amino acids 776-1130 and having a molecular weight of approximately 50kDa. Dengue NS1 ST4 is purified by proprietary chromatographic technique.
Source
Insect cells.
Formulation
Dengue NS1 ST4 protein solution in 1xD-PBS, pH7.4, 0.1% Thimerosal, 5mM EDTA, 1?g/ml of Leupeptin, Aprotinin and Pepstatin A.
Purity
Protein is >95% pure as determined by 12.5% SDS-PAGE.
More Info
-
Introduction
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
IFI30 HumanDescription:
IFN Gamma-Inducible protein 30 Human Recombinant
IFI30, Gamma-IFN-Inducible Lysosomal Thiol Reductase, IFN Gamma-Inducible Protein 30 Preproprotein, Gamma-IFN-Inducible Protein IP-30, Legumaturain, GILT, IP30, IFI-30, MGC32056, EC 1.8.
Product # :
CYT-183Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
- SDS-PAGE
Description
IFI30 Human Recombinant produced in E. coli is a single polypeptide chain containing 199 amino acids (58-232) and having a molecular mass of 22.5 kDa. IFI30 is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Source
E.coli.
Formulation
The IFI30 solution (1mg/1ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.1M NaCl, 1mM DTT and 10% glycerol.
Purity
Greater than 90% as determined by SDS-PAGE.
SDS-PAGE
More Info
-
Introduction
IFNI30 inducible lysosomal thiol reductase (IFI30), is a part of the GILT family. IFI30 is a lysosomal thiol reductase which at low pH is capable of decreasing protein’s disulfide bonds. IFI30 is expressed constitutively in antigen-presenting cells and induced by gamma-IFN in other cell types. Also, IFI30 plays an important role in MHC class II-restricted antigen processing. IFI30 facilitates the generation of MHC class II-restricted epitopes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds and Also facilitates MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or cross-presentation.
-
Synonyms
IFI30, Gamma-IFN-Inducible Lysosomal Thiol Reductase, IFN Gamma-Inducible Protein 30 Preproprotein, Gamma-IFN-Inducible Protein IP-30, Legumaturain, GILT, IP30, IFI-30, MGC32056, EC 1.8.
-
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
MGSSHHHHHH SSGLVPRGSH MGSMNAPLVN VTLYYEALCG GCRAFLIREL FPTWLLVMEI LNVTLVPYGN AQEQNVSGRW EFKCQHGEEE CKFNKVEACV LDELDMELAF LTIVCMEEFE DMERSLPLCL QLYAPGLSPD TIMECAMGDR GMQLMHANAQ RTDALQPPHE YVPWVTVNGK PLEDQTQLLT LVCQLYQGK.
-
Background
What is the molecular weight/Mw of IFI30 HUMAN Protein?
IFI30 HUMAN Protein has a total Mw of 22.5kDa.
What is the source or expression system of IFI30 HUMAN Protein?
Escherichia Coli.
What is the Purity of IFI30 HUMAN Protein?
IFI30 HUMAN Protein is >90% pure as determined by SDS-PAGE.
What is the Biological Activity of IFI30 HUMAN Protein?
The biological functionality of IFI30 HUMAN Protein will be determined in the future.
What is the amino acid sequence of IFI30 HUMAN Protein?
MGSSHHHHHH SSGLVPRGSH MGSMNAPLVN VTLYYEALCG GCRAFLIREL FPTWLLVMEI LNVTLVPYGN AQEQNVSGRW EFKCQHGEEE CKFNKVEACV LDELDMELAF LTIVCMEEFE DMERSLPLCL QLYAPGLSPD TIMECAMGDR GMQLMHANAQ RTDALQPPHE YVPWVTVNGK PLEDQTQLLT LVCQLYQGK.
What applications can IFI30 HUMAN Protein be used in?
IFI30 HUMAN Protein can probably be used in western blot, ELISA and Lateral Flow.
What is the endotoxin level for IFI30 HUMAN Protein?
The endotoxin level is minimal, IFI30 HUMAN Protein was purified using conventional chromatography techniques.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
IL 12 p40 HumanDescription:
Interleukin-12 p40 Human Recombinant
NKSF2, CTL maturation factor (TCMF), Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), TSF, Edodekin-alpha, IL-12 p40, IL-12B, IL-12 subunit p40, NK cell stimulatory factor chain 2.
Product # :
CYT-488Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Interleukin-12 p40 His Human Recombinant produced in E.Coli is single, a non-glycosylated, polypeptide chain containing 306 amino acids fragment (23-328) with an amino-terminal hexahistidine tag. The IL-12 p40 His is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Interleukin-12 p40 His is supplied in 1xPBS and 50% glycerol.
Purity
Greater than 95.0% as determined by SDS-PAGE.
More Info
-
Introduction
Active IL-12 is a p70 disulphide-linked dimer composed of p35 and p40 subunits. The protein is a pleiotropic cytokine produced primarily by antigen presenting cells and has multiple effects on T lymphocytes and natural killer cells in terms of stimulating cytotoxicity, proliferation, production of other cytokines and Th1 subset differentiation.
-
Synonyms
NKSF2, CTL maturation factor (TCMF), Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), TSF, Edodekin-alpha, IL-12 p40, IL-12B, IL-12 subunit p40, NK cell stimulatory factor chain 2.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Borrelia Bavariensis DbpADescription:
Borrelia Bavariensis DbpA Recombinant
Decorin binding protein A, dbpA.
Product # :
BOR-023Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Borrelia Bavariensis DbpA produced in E.coli is a non-glycosylated, polypeptide chain having a calculated molecular mass of 18kDa. Borrelia Bavariensis DbpA is expressed with a 10x His tag at N-terminus and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Borrelia Bavariensis DbpA is supplied in 20mM HEPES buffer pH-7.6, 250mM NaCl and 20% glycerol.
Purity
Greater than 80.0% as determined by SDS-PAGE.
More Info
-
Introduction
Borrelia is a part of a genus of bacteria of the spirochete phylum. Borrelia causes borreliosis, which is a zoonotic, vector-borne disease transmitted mainly by ticks and some by lice, depending on the species. Borreliella bavariensis is one of the pathogens of the Borreliella burgdorferi sensu lato complex which causes Lyme disease. Decorin binding protein A (DbpA), also known as Osp17 or p17 is expressed during the mammalian phase of infection. DbpA is binds the pathogen to host collagen-associated proteoglycan decorin.
-
Synonyms
Decorin binding protein A, dbpA.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
-
Immunological Functions
1. Binds IgG- and IgM-type human antibodies.2. Immunodot test with Lyme disease positive/negative patient samples.
-
Applications
Western blot with Patient sample.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Borrelia OspCDescription:
Borrelia Burgdorferi Outer Surface Protein C Recombinant
Product # :
BOR-004Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Borrelia Burgdorferi Outer Surface Protein C produced in E.coli is a non-glycosylated, polypeptide chain having a calculated molecular mass of 26kDa. Borrelia OspC is expressed with a -6x His tag at N-terminus and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Formulation
Borrelia OspC is supplied in 16mM HEPES buffer pH-7.0, 300mM NaCl and 20% glycerol.
Purity
Greater than 80.0% as determined by SDS-PAGE.
More Info
-
Introduction
Borrelia belongs to a genus of bacteria of the spirochete phylum. Borrelia causes borreliosis, which is a zoonotic, vector-borne disease transmitted mainly by ticks and some by lice, depending on the species. Of the 36 known species of Borrelia, 12 are distinguished to cause Lyme disease or borreliosis and are transmitted by ticks. The main Borrelia species causing Lyme disease are Borrelia burgdorferi, Borrelia afzelii, and Borrelia garinii. The Borrelia genus members have a linear chromosome which is about 900 kbp in length as well as an excess of both linear and circular plasmids in the 5-220 kbp size range. The plasmids are atypical, as compared to most bacterial plasmids, since they contain many paralogous sequences, a large number of pseudogenes and, in some cases, essential genes. Moreover, a number of the plasmids have features suggesting that they are prophages.
-
Physical Appearance
Sterile Filtered clear solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
-
Applications
Western blot with Lyme positive plasma.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
HAVCR2 Human, Sf9Description:
Hepatitis A Virus Cellular Receptor 2 Human Recombinant, Sf9
Hepatitis A virus cellular receptor 2, HAVCR2, Hepatitis A virus cellular receptor 2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3, TIMD-3, T-cell immunoglobulin mucin receptor 3, TIM-3, T-cell membrane protein 3, TIM3, TIMD3, KIM-3.
Product # :
HAV-221Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- source
- formulation
- purity
- More Info
Description
Recombinant Human HAVCR2 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 423 amino acids (aa 22-202) and having a molecular mass of 47.3kDa. (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). HAVCR2 is fused to a 239 amino acid hIgG-His-tag at C-terminus & purified by proprietary chromatographic techniques.
Source
Sf9, Baculovirus cells.
Formulation
The HAVCR2 solution (0.5mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Purity
Greater than 85% as determined by SDS-PAGE.
More Info
-
Introduction
Hepatitis A Virus Cellular Receptor 2 (HAVCR2) is a member of the immunoglobulin superfamily. HACVR2 controls macrophage activation. HACVR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and stimulates immunological tolerance.
-
Synonyms
Hepatitis A virus cellular receptor 2, HAVCR2, Hepatitis A virus cellular receptor 2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3, TIMD-3, T-cell immunoglobulin mucin receptor 3, TIM-3, T-cell membrane protein 3, TIM3, TIMD3, KIM-3.
-
Physical Appearance
Sterile filtered colorless solution.
-
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
-
Amino Acid Sequence
ADLSEVEYRA EVGQNAYLPC FYTPAAPGNL VPVCWGKGAC PVFECGNVVL RTDERDVNYW TSRYWLNGDF RKGDVSLTIE NVTLADSGIY CCRIQIPGIM NDEKFNLKLV IKPAKVTPAP TRQRDFTAAF PRMLTTRGHG PAETQTLGSL PDINLTQIST LANELRDSRL ANDLRDSGAT IRIGLEPKSC DKTHTCPPCP APELLGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD GVEVHNAKTK PREEQYNSTY RVVSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPGKHHH HHH.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CoV-2 Envelope (1-75)Description:
Coronavirus 2019 Envelope (1-75 a.a.), Recombinant
Product # :
SARS-037Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- description
- source
- formulation
- purity
- More Info
Description
The E.coli derived recombinant protein contains the Coronavirus 2019 CoV-2 Envelope, Wuhan-Hu-1 strain, amino acids 1-75 fused to GST-tag at N-terminal & His-tag at C-terminal having a calculated Mw of 36.8 kDa and migrating between 33-35 umder reducing condition.
Source
E.Coli
Formulation
CoV-2 Envelope protein is supplied in 20mM Tris, 5mM EDTA & 0.5M Arginine, pH-8 and 10% sucrose.
Purity
Protein is >90% pure as determined SDS-PAGE.
More Info
-
Introduction
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.
The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.
While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.
-
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
-
Stability
Lyophilized Cov-2 Envelope protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CoV2 Envelope protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
-
Solubility
It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely.
-
Purification Method
Purified by Metal-Afinity chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
CoV-2 N (1-419), HEKDescription:
Coronavirus 2019 Nucleocapsid (1-419 a.a.), Recombinant, HEK
Product # :
SARS-035Price :
Quantity :
Shipping Method :
Shipped at Room temp
More Info
- description
- source
- formulation
- purity
- More Info
Description
The HEK293 derived recombinant protein contains the Coronavirus 2019 CoV-2 Nucleocapsid, Wuhan-Hu-1 strain, amino acids 1-419 fused to His tag at C-terminal having a calculated Mw of 47.3 kDa and migrating between 60-65 due to glycosylation.
Source
HEK293 Cells.
Formulation
CoV-2 Nucleocapsid protein is supplied in 1x PBS pH-7.4 & 10% trehalose.
Purity
Protein is >95% pure as determined SDS-PAGE.
More Info
-
Introduction
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.
The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.
While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.
-
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
-
Stability
Lyophilized Cov-2 Nucleocapsid protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CoV2 Nucleocapsid protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
-
Solubility
It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely.
-
Purification Method
Purified by Metal-Afinity chromatographic technique.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Influenza-B MalaysiaDescription:
Influenza-B Virus Malaysia/2506/04
Product # :
IHA-025Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza B virus, strain B/Malaysia/2506/04. The Influenza B Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The B/Malaysia/2506/04 solution contains STE, 0.1% sodium azide (NaN3) and 0.005% thimerosal.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
Influenza-B virus is a genus in the virusfamily Orthomyxoviridae. The only species in this genus is called "Influenza B virus". Influenza B virus only infects humansand seals. This limited host range is apparently in contrast with those caused by the similar Influenza virus Aas both mutate by both genetic drift and reassortment. Influenza-B virus evolves slower than A viruses and faster than C viruses. Influenza-B virus mutates at a rate 2-3 times lower than type A. However, influenza B mutates enough that lasting immunity is not possible. The Influenza B virus capsidis enveloped while its virionconsists of a matrix protein + envelope + nucleoprotein complex + nucleocapsid, and a polymerasecomplex. Influenza B is sometimes spherical and sometimes filamentous. Its 500 or so surface projections are made of hemagglutinin and neuraminidase.
The Influenza B virus is 14648 nucleotideslong and consists of eight segments of linear negative-sense, single-stranded RNA. The multipartite genome is encapsidated, each segment in a separate nucleocapsid, and the nucleocapsids are surrounded by one envelope. -
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
B/Malaysia/2506/04 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Inactivation
Thimerosal and beta propiolactone treatmentThis product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Serological studies of influenza B virus, immunogen for antibody production.Tested with anti-influenza B monoclonal antibodies in ELISA.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- View Data Sheet
Name :
Influenza-B VictoriaDescription:
Influenza-B Virus Victoria/504/00
Product # :
IHA-018Price :
Quantity :
Shipping Method :
Shipped with Ice Packs
More Info
- description
- formulation
- purity
- More Info
Description
Allantoic fluid of 10 days old embryonated eggs, inoculated with influenza B virus, strain B/Victoria/504/00. The Influenza B Virus was purified by Ultracentrifugation with 10-40 % sucrose gradient.
Formulation
The B/ Victoria /53/99 solution contains STE, 0.1% sodium azide (NaN3) and 0.005% thimerosal.
Purity
Greater than 90.0% as determined by SDS-PAGE.
More Info
-
Introduction
Influenzavirus B is a genus in the virusfamily Orthomyxoviridae. The only species in this genus is called "Influenza B virus". Influenza B virus only infects humansand seals. This limited host range is apparently in contrast with those caused by the similar Influenza virus Aas both mutate by both genetic drift and reassortment. Influenza-B virus evolves slower than A viruses and faster than C viruses. Influenza-B virus mutates at a rate 2-3 times lower than type A. However, influenza B mutates enough that lasting immunity is not possible. The Influenza B virus capsidis enveloped while its virionconsists of a matrix protein + envelope + nucleoprotein complex + nucleocapsid, and a polymerasecomplex. Influenza B is sometimes spherical and sometimes filamentous. Its 500 or so surface projections are made of hemagglutinin and neuraminidase.
The Influenza B virus is 14648 nucleotideslong and consists of eight segments of linear negative-sense, single-stranded RNA. The multipartite genome is encapsidated, each segment in a separate nucleocapsid, and the nucleocapsids are surrounded by one envelope. -
Physical Appearance
Sterile Filtered colorless solution.
-
Stability
B/Victoria/504/00 although stable 4°C for 4 weeks, should be stored below -18°C. Please prevent freeze-thaw cycles.
-
Applications
Serological studies of influenza B virus, immunogen for antibody production.
-
Inactivation
Thimerosal and beta propiolactone treatmentThis product has been treated in a manner consistent with methods of inactivation. Generally accepted good laboratory practices appropriate to microbiological/viral safe handling practices and techniques are required at work.
-
Immunological Activity
Tested with anti-influenza B monoclonal antibodies in ELISA.
-
Note
Contains thimerosal (0.005%) and sodium azide (0.1%) as preservative. Although the amounts are very small, appropriate care must be taken when handling this product.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.