Skip to content

High-quality research proteins.

  • 1-800-805-6531

  • Mon - Sat 8.00-18.00, Sun - Closed

  • info@prospecbio.com

  • PO Box 6591 East Brunswick NJ 08816

  • Products
    • Cytokines
    • Growth factors
    • Chemokines
    • Cd antigens
    • Neurotrophins
    • Hormones
    • Enzymes
    • Viral antigens
    • Recombinant proteins
    • Natural proteins
    • Monoclonal antibodies
    • Polyclonal antibodies
    • Thermal Packaging
  • About
    • Company
    • Founder
    • Contribution
  • Customers
    • Eastern Asia
    • Eastern Europe
    • North America
    • South America
    • South East Asia
    • Southern Asia
    • Western Europe
  • Ordering
    • Ordering Method
    • Ordering - Credit Card
    • Ordering - PO
    • Shipping Fees
    • FAQs
  • Services
    • DNA Cloning
    • Protein Expression
    • Monoclonal Antibody
    • Fermentation
    • Technology License
  • Contact us
Log in

Country/region

  • USD $ | Albania
  • USD $ | Andorra
  • USD $ | Argentina
  • USD $ | Armenia
  • USD $ | Australia
  • USD $ | Austria
  • USD $ | Azerbaijan
  • USD $ | Belarus
  • USD $ | Belgium
  • USD $ | Bolivia
  • USD $ | Brazil
  • USD $ | Bulgaria
  • USD $ | Cambodia
  • USD $ | Canada
  • USD $ | Chile
  • USD $ | China
  • USD $ | Colombia
  • USD $ | Costa Rica
  • USD $ | Croatia
  • USD $ | Cyprus
  • USD $ | Czechia
  • USD $ | Denmark
  • USD $ | Estonia
  • USD $ | Finland
  • USD $ | France
  • USD $ | Georgia
  • USD $ | Germany
  • USD $ | Greece
  • USD $ | Hong Kong SAR
  • USD $ | Hungary
  • USD $ | Iceland
  • USD $ | India
  • USD $ | Ireland
  • USD $ | Israel
  • USD $ | Italy
  • USD $ | Japan
  • USD $ | Kazakhstan
  • USD $ | Latvia
  • USD $ | Liechtenstein
  • USD $ | Lithuania
  • USD $ | Madagascar
  • USD $ | Malta
  • USD $ | Mexico
  • USD $ | Moldova
  • USD $ | Monaco
  • USD $ | Netherlands
  • USD $ | New Zealand
  • USD $ | North Macedonia
  • USD $ | Norway
  • USD $ | Panama
  • USD $ | Paraguay
  • USD $ | Peru
  • USD $ | Philippines
  • USD $ | Poland
  • USD $ | Portugal
  • USD $ | Romania
  • USD $ | Singapore
  • USD $ | Slovakia
  • USD $ | Slovenia
  • USD $ | South Africa
  • USD $ | South Korea
  • USD $ | Spain
  • USD $ | Sri Lanka
  • USD $ | Sweden
  • USD $ | Switzerland
  • USD $ | Taiwan
  • USD $ | Thailand
  • USD $ | Türkiye
  • USD $ | Ukraine
  • USD $ | United Kingdom
  • USD $ | United States
  • USD $ | Uruguay
  • USD $ | Vatican City
  • USD $ | Venezuela
  • USD $ | Vietnam
  • Facebook
  • Instagram
logoProSpec - Recombinant Protein Manufacturer for academic and R&D industry
Become a distributor
Account Log in
Wishlist
Cart Cart(0)
  • Products
    +
    • Cytokines
    • Growth factors
    • Chemokines
    • Cd antigens
    • Neurotrophins
    • Hormones
    • Enzymes
    • Viral antigens
    • Recombinant proteins
    • Natural proteins
    • Monoclonal antibodies
    • Polyclonal antibodies
    • Thermal Packaging
  • About
    +
    • Company
    • Founder
    • Contribution
  • Customers
    +
    • Eastern Asia
    • Eastern Europe
    • North America
    • South America
    • South East Asia
    • Southern Asia
    • Western Europe
  • Ordering
    +
    • Ordering Method
    • Ordering - Credit Card
    • Ordering - PO
    • Shipping Fees
    • FAQs
  • Services
    +
    • DNA Cloning
    • Protein Expression
    • Monoclonal Antibody
    • Fermentation
    • Technology License
  • Contact us

Item added to your cart

View cart
View All
  • Cytokines
  • Growth factors
  • Chemokines
  • Cd antigens
  • Neurotrophins
  • Hormones
  • Enzymes
  • Viral antigens
  • Recombinant proteins
  • Natural proteins
  • Monoclonal antibodies
  • Polyclonal antibodies
  • Thermal Packaging
  • Tumor Necrosis Factor

    Tumor Necrosis Factor

    View All
  • 4-1BB

    4-1BB

    View All
  • Adiponectin

    Adiponectin

    View All
  • AIF1

    AIF1

    View All
  • Other Cytokines

    Other Cytokines

    View All
  • AITRL

    AITRL

    View All
  • Angiopoietin

    Angiopoietin

    View All
  • Apolipoprotein

    Apolipoprotein

    View All
  • B-Cell Activating Factor

    B-Cell Activating Factor

    View All
  • Beta Defensin

    Beta Defensin

    View All
  • Bone Morphogenetic Protein

    Bone Morphogenetic Protein

    View All
  • B type Natriuretic Peptide

    B type Natriuretic Peptide

    View All
  • BST

    BST

    View All
  • Betacellulin

    Betacellulin

    View All
  • Cardiotrophin

    Cardiotrophin

    View All
  • Activin

    Activin

    View All
  • Fibroblast Growth Factor

    Fibroblast Growth Factor

    View All
  • Other Growth Factors

    Other Growth Factors

    View All
  • CSF

    CSF

    View All
  • CTGF

    CTGF

    View All
  • IGFBP

    IGFBP

    View All
  • VEGF Protein

    VEGF Protein

    View All
  • EGF

    EGF

    View All
  • Epigen

    Epigen

    View All
  • Erythropoietin

    Erythropoietin

    View All
  • Insulin-Like Growth Factor

    Insulin-Like Growth Factor

    View All
  • Growth Hormone

    Growth Hormone

    View All
  • HDGF

    HDGF

    View All
  • Hepatocyte Growth Factor

    Hepatocyte Growth Factor

    View All
  • Insulin

    Insulin

    View All
  • BCA-1/ BLC (CXCL13)

    BCA-1/ BLC (CXCL13)

    View All
  • BRAK (CXCL14)

    BRAK (CXCL14)

    View All
  • C-10 (CCL6)

    C-10 (CCL6)

    View All
  • Other Chemokines

    Other Chemokines

    View All
  • MEC (CCL28)

    MEC (CCL28)

    View All
  • LD78-beta (CCL3L1)

    LD78-beta (CCL3L1)

    View All
  • CTACK (CCL27)

    CTACK (CCL27)

    View All
  • CXCL16

    CXCL16

    View All
  • CXCL17

    CXCL17

    View All
  • Platelet Factor-4 (CXCL4)

    Platelet Factor-4 (CXCL4)

    View All
  • ENA-78 (CXCL5)

    ENA-78 (CXCL5)

    View All
  • Eotaxin (CCL11,24,26)

    Eotaxin (CCL11,24,26)

    View All
  • Exodus-2 (CCL21)

    Exodus-2 (CCL21)

    View All
  • Fractalkine (CX3CL1)

    Fractalkine (CX3CL1)

    View All
  • CXCL6

    CXCL6

    View All
  • Other CD Antigens

    Other CD Antigens

    View All
  • CD14

    CD14

    View All
  • CD164

    CD164

    View All
  • CD1

    CD1

    View All
  • CD2

    CD2

    View All
  • CD200

    CD200

    View All
  • CD207

    CD207

    View All
  • CD226

    CD226

    View All
  • CD23

    CD23

    View All
  • CD244

    CD244

    View All
  • CD247

    CD247

    View All
  • CD27

    CD27

    View All
  • CD274

    CD274

    View All
  • CD300

    CD300

    View All
  • CD33

    CD33

    View All
  • Other Neurotrophins

    Other Neurotrophins

    View All
  • Beta-NGF

    Beta-NGF

    View All
  • BDNF

    BDNF

    View All
  • CDNF

    CDNF

    View All
  • CNTF

    CNTF

    View All
  • GDNF

    GDNF

    View All
  • Glia Maturation Factor

    Glia Maturation Factor

    View All
  • MANF

    MANF

    View All
  • Midkine

    Midkine

    View All
  • Neuroglobin

    Neuroglobin

    View All
  • Neurotrophic factors

    Neurotrophic factors

    View All
  • Neuregulin

    Neuregulin

    View All
  • Neuropilin

    Neuropilin

    View All
  • Pigment Epithelium-Derived Factor

    Pigment Epithelium-Derived Factor

    View All
  • Pleiotrophin

    Pleiotrophin

    View All
  • Peptide Hormones

    Peptide Hormones

    View All
  • Other Hormones

    Other Hormones

    View All
  • HCG

    HCG

    View All
  • Endothelin

    Endothelin

    View All
  • Exendin

    Exendin

    View All
  • FSH

    FSH

    View All
  • Glucagon

    Glucagon

    View All
  • GHRP

    GHRP

    View All
  • GLP

    GLP

    View All
  • Thyrostimulin

    Thyrostimulin

    View All
  • Inhibin A

    Inhibin A

    View All
  • LHRH

    LHRH

    View All
  • Melanotan

    Melanotan

    View All
  • Procalcitonin

    Procalcitonin

    View All
  • PTH

    PTH

    View All
  • Peroxiredoxin

    Peroxiredoxin

    View All
  • Peptidase

    Peptidase

    View All
  • Synthetase

    Synthetase

    View All
  • Transferase

    Transferase

    View All
  • Hydrolase

    Hydrolase

    View All
  • Dehydrogenase

    Dehydrogenase

    View All
  • ACE2

    ACE2

    View All
  • Esterase

    Esterase

    View All
  • Protein Kinases

    Protein Kinases

    View All
  • Other Enzymes

    Other Enzymes

    View All
  • Phosphatase

    Phosphatase

    View All
  • Deaminase

    Deaminase

    View All
  • Oxygenase

    Oxygenase

    View All
  • Adenylate Kinase

    Adenylate Kinase

    View All
  • Lyase

    Lyase

    View All
  • Chagas

    Chagas

    View All
  • SARS

    SARS

    View All
  • Influenza

    Influenza

    View All
  • ASFV

    ASFV

    View All
  • Astrovirus

    Astrovirus

    View All
  • Borrelia

    Borrelia

    View All
  • Helicobacter Pylori

    Helicobacter Pylori

    View All
  • Chikungunya

    Chikungunya

    View All
  • Chlamydia

    Chlamydia

    View All
  • Cytomegalo

    Cytomegalo

    View All
  • Dengue

    Dengue

    View All
  • EBV

    EBV

    View All
  • Ebola

    Ebola

    View All
  • Feline Leukemia Virus

    Feline Leukemia Virus

    View All
  • Hepatitis A

    Hepatitis A

    View All
  • Other

    Other

    View All
  • Actin

    Actin

    View All
  • ADAM

    ADAM

    View All
  • Complement Component

    Complement Component

    View All
  • Ag85

    Ag85

    View All
  • Eukaryotic Translation Initiation Factor

    Eukaryotic Translation Initiation Factor

    View All
  • Anterior Gradient Protein

    Anterior Gradient Protein

    View All
  • Heat Shock Protein

    Heat Shock Protein

    View All
  • Alpha-2-HS-Glycoprotein

    Alpha-2-HS-Glycoprotein

    View All
  • Hemoglobin

    Hemoglobin

    View All
  • Allergy

    Allergy

    View All
  • Anaplasma

    Anaplasma

    View All
  • Angiogenin

    Angiogenin

    View All
  • Ankyrin Repeat Domain

    Ankyrin Repeat Domain

    View All
  • Annexin

    Annexin

    View All
  • Other Natural Proteins

    Other Natural Proteins

    View All
  • Aprotinin

    Aprotinin

    View All
  • Transferrin

    Transferrin

    View All
  • Avidin

    Avidin

    View All
  • Anti Coagulation Factors

    Anti Coagulation Factors

    View All
  • Natural Albumin

    Natural Albumin

    View All
  • Natural Coagulation Factors

    Natural Coagulation Factors

    View All
  • Fibronectin

    Fibronectin

    View All
  • Thrombin

    Thrombin

    View All
  • Anti Human Enzyme

    Anti Human Enzyme

    View All
  • Other Monoclonal Antibodies

    Other Monoclonal Antibodies

    View All
  • Anti Human Cytokine

    Anti Human Cytokine

    View All
  • Anti Human Heat Shock Protein

    Anti Human Heat Shock Protein

    View All
  • Anti Mouse Lymphocyte

    Anti Mouse Lymphocyte

    View All
  • Anti Human Chemokine

    Anti Human Chemokine

    View All
  • Anti Human Lymphocyte

    Anti Human Lymphocyte

    View All
  • Anti Viral Monoclonal

    Anti Viral Monoclonal

    View All
  • Anti Mouse Cytokine

    Anti Mouse Cytokine

    View All
  • Anti-GST Monoclonal

    Anti-GST Monoclonal

    View All
  • Other Polyclonal Antibodies

    Other Polyclonal Antibodies

    View All
  • Anti Viral

    Anti Viral

    View All
  • Anti-GST Monoclonal

    Anti-GST Monoclonal

    View All
Back

Search results

1000 results found for “anti viral”

Name

Description

Product #

Price

Quantity

Shipping Method

  • View Data Sheet

    Name :

    HERV-K

    Description:

    Endogenous retrovirus K Envelope Human Recombinant

    Product # :

    HER-001

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The E.Coli derived HERV-K recombinant truncated protein is fused to a Six histidine tag at C-terminus and has a MW of 51.5kDa (pI 9.06).

    Source

    Escherichia Coli.

    Formulation

    10mM Tris-HCl, pH 7.2.

    Purity

    Protein is >90% pure as determined by SDS PAGE.

    More Info

    • Introduction

      HERVK is related with several tumors such as passenger virus, and anti-Retroviral therapy against amyotrophic lateral sclerosis/ALS has exhibited to decrease the symptoms of amyotrophic lateral sclerosis/ALS. High counts of viral sequences exist in the human genome but stay silent. Though, in pathological conditions, these viruses are produced. Human Endogenous Retrovirus-K, is produced in neurons of a subpopulation of patients with amyotrophic lateral sclerosis/ALS, a progressive neurodegenerative disease. The envelope protein of this HERV results in degeneration of neurons, and transgenic animals producing this protein advance an ALS-like syndrome triggered by nucleolar dysfunction in motor neurons. Reactivation of the HERVK is controlled by the transcription factor TDP-43. Therefore, therapeutic tactics against this virus alter the course of the disease.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      HERV-K although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Amino Acid Sequence

      MWTVPSFTND SYQVYNVFST NSFQLLTVKR TPHEAWRVPL TTKTNKTKGL PDCPKKPTNG PFIVTSILWD NCNAPKAVVL QTLAMGIVID WAPKGHYWQD CSSKNTLCSE FIYSLDYIEH GWQSYTMRQR VSPYPFKWMD TGIAPPRPKI IHPFFTPEHP ELWKLAAALS GIKIWNTTYQ LLRTKTKTPT FNITLISEWV IPIRSCVKPP YMLLVGNIIM MPDAQTIECH NCKLFTCIDA TFNPTTSILL VRAREGVWIP VSLHRPWESS PSIHIVNEVL KDILKRTKRF IFTLIAVLAG LLAVTATAAT AGVAIRSSVQ TAHYVEACQK NSSRLWNSQA QIDQKLANQI NDLRQSVTWL GDRVMNLQHR MQLQCDWNTS DYCITPYAYN QDQHSWENVS RHLKAWDDNL TLDISQLKEQIFEASQAHLS TVPGSHIFEG ITKQLPDFNP FKWLKPVRGS LLLLALLILV CLCCLLLVCRCL.

    • Applications

      Detection of Human Endogenious Retrovirus K in individuals is untested.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Human Endogenous Retrovirus K
  • View Data Sheet

    Name :

    HAVCR1 Mouse

    Description:

    Hepatitis A Virus Cellular Receptor 1 Mouse Recombinant

    Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, Kidney injury molecule 1, KIM-1, T cell immunoglobulin and mucin domain-containing protein 1, TIMD-1, T cell membrane protein 1, T-cell immunoglobulin mucin receptor 1, TIM-1.

    Product # :

    HAV-232

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    HAVCR1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 222 amino acids (22-237 a.a.) and having a molecular mass of 24.4kDa (Migrates at 40-57kDa on SDS-PAGE under reducing conditions). HAVCR1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

    Source

    Sf9, Baculovirus cells.

    Formulation

    HAVCR1 protein solution (0.25mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol.

    Purity

    Greater than 90.0% as determined by SDS-PAGE.

    More Info

    • Introduction

      Hepatitis A virus cellular receptor 1 (HAVCR1) is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. HAVCR1 is a type I trans-membrane structural glycoprotein located in the renal proximal tubule epithelial cells. HAVCR1 protein may be involved in the control of asthma and allergic diseases. The reference genome represents an allele which retains a MTTVP amino acid segment that presents defense against atopy in HHAV seropositive individuals.

    • Synonyms

      Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, Kidney injury molecule 1, KIM-1, T cell immunoglobulin and mucin domain-containing protein 1, TIMD-1, T cell membrane protein 1, T-cell immunoglobulin mucin receptor 1, TIM-1.

    • Physical Appearance

      Sterile Filtered colorless solution.

    • Stability

      Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

    • Amino Acid Sequence

      YVEVKGVVGH PVTLPCTYST YRGITTTCWG RGQCPSSACQ NTLIWTNGHR VTYQKSSRYN LKGHISEGDV SLTIENSVES DSGLYCCRVE IPGWFNDQKV TFSLQVKPEI PTRPPTRPTT TRPTATGRPT TISTRSTHVP TSIRVSTSTP PTSTHTWTHK PEPTTFCPHE TTAEVTGIPS HTPTDWNGTV TSSGDTWSNH TEAIPPGKPQ KNPTKGHHHH HH.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Havcr1 Mouse
  • View Data Sheet

    Name :

    Zika NS1, HEK

    Description:

    Zika NS1 Protein Recombinant, HEK

    Product # :

    ZKV-003

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The HEK derived recombinant Zika NS1 protein strain MR-766 (Prototype, Uganda, 1947, GenBank accession number AY632535).The Zika NS1 protein is fused to a 6xHis tag at C-terminus and purified by proprietary chromatographic technique.

    Source

    Human Embryonic Kidney 293 cells.

    Formulation

    Zika NS1 protein contains Dulbecco’s Phosphate buffered saline, pH 7.4.

    Purity

    Zika NS1 protein is >90% pure as determined by SDS-PAGE.

    More Info

    • Introduction

      Zika virus (ZIKV) belongs to the family Flaviviridae and the genus Flavivirus, it is transmitted by daytime-active Aedes mosquitoes, such as A. aegypti and A. albopictus. The Zika virus is related to the dengue, yellow fever, Japanese encephalitis, and West Nile viruses. Much like the other flaviviruses, Zika virus is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Zika fever is an infection, which often causes no symptoms or only mild ones, like a mild form of dengue fever, and it is treated by rest. As of February 2016, there has been mounting evidence that Zika fever in pregnant women can cause abnormal brain development in their fetuses by mother-to-child transmission, which may result in miscarriage or microcephaly, however it is not yet known whether Zika virus causes microcephaly. Furthermore, a connection has been established with neurologic conditions in infected adults, including Guillain–Barre syndrome.

    • Physical Appearance

      Sterile Filtered solution.

    • Stability

      Zika NS1 protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      Each laboratory should determine an optimum working titer for use in its particular application.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Zika Ns1 Hek
  • View Data Sheet

    Name :

    HCV Mosaic-A

    Description:

    Hepatitis C Virus Mosaic Antigen-A Recombinant

    Product # :

    HCV-001

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    HCV Mosaic-A protein contains a short core peptide residue 1-50a.a., 1269-1316a.a. of NS3, three epitopes from NS4 and two epitopes from NS5 and the genotype of all sequences are 1b. A specific peptide was identified from each region; the four peptides from each region were linked together and expressed in E .coli. The recombinant protein migrates at 33kDa.

    Source

    Escherichia Coli.

    Formulation

    HCV Mosaic-A protein solution containing PBS.

    Purity

    Protein is >95% pure as determined by 12% PAGE (coomassie staining).

    More Info

    • Introduction

      Hepatitis C is one type of viral hepatitis - a liver disease - caused by the hepatitis C virus (HCV) which is usually passed through contact with infected blood but can also pass through sex with an infected person and from mother to baby during childbirth.
      HCV core protein, NS3, NS4, and NS5 proteins of hepatitis C virus are all essential for detection of antibodies against HCV.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

    • Applications

      ELISA, gold conjugation.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Mosaic A
  • View Data Sheet

    Name :

    HBeAg

    Description:

    Hepatitis B Virus e-Antigen Recombinant

    Product # :

    HBV-272

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    Recombinant hepatitis B virus “e” antigen is fused to a His Tag and having a molecular mass of approximately 18kDa.

    Source

    Escherichia Coli.

    Formulation

    20mM Tris-Hcl, 0.5M NaCl and 0.8M imidazole.

    Purity

    Protein is >95%

    More Info

    • Introduction

      Hepatitis B virus is the main cause for human liver disease, chronic infection frequently causes liver cancer and cirrhosis. The HBV core gene codes 2 distinct protein products, a 21.5-kDa protein being assembled to form nucleocapsid particles designated HBcAg, which wraps the viral DNA as well as the viral polymerase and RNase H, and a precore protein, designated as HBeAg, which is directly to the endoplasmic reticulum, processed at N- and C-terminally and secreted as non-particulate e-anitgen (HBeAg). The pre-core protein contains an extra 29 N-terminal amino acids, serving as a signal peptide to direct the nascent polypeptide into secretory pathway. After the secretion, mature HBeAg is deleted at the residue 149 C-terminally and retains 10 precore residues N-terminally. HBcAg and HBeAg are distinctly recognized by antibodies but highly cross-reactive at the T-cell level.
      The e antigen is found in the circulation, it is found during the active HBV infection, positive result indicates the risk for contagiousness, and is also used as indicator for the effectiveness of HBV treatment. Positive anti-HBeAg specifies an active stage of acute HBV infection that is in its final stages, the risk for contagiousness is dramatically reduced.

    • Stability

      HBeAg although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Amino Acid Sequence

      s klclgwlwgm didpykefga svellsflps dffpsirdll dtasalyrea lespehcsph htalrqailc

      wgelmnlatw vgsnledpas relvvsyvnv nmglkirqll wfhiscltfg retvleylvs fgvwirtpta

      yrppnapils tlpettvv

    • Purification Method

      Purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hbeag
  • View Data Sheet

    Name :

    HSV-2 gD

    Description:

    Herpes Simplex Virus-2 gD Recombinant

    Product # :

    HSV-222

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.Coli derived 39.7 kDa recombinant protein contains the HSV-2 gD immunodominant regions 266-394 amino acids, fused with 26 kDa GST-tag.

    Formulation

    25mM Tris pH 7.2, 1mM EDTA, and 50% glycerol.

    Purity

    HSV-2 gD protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      Entry of HSV into the host cell involves interactions of several viral glycoproteins with cell surface receptors. The virus particle is covered by an envelope which, when bound to specific receptors on the cell surface, will fuse with the cell membrane and create an opening, or pore, through which the virus enters the host cell. The sequential stages of HSV entry are analagous to those of other viruses. At first, complementary receptors on the virus and cell surface bring the two membranes into proximity. In an intermediate state, the two membranes begin to merge, forming a hemifusion state. Finally, a stable entry pore is formed through which the viral envelope contents are introduced to the host cell.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      HSV-2 gD Protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Specificity

      Immunoreactive with sera of HSV-infected individuals.

    • Purification Method

      HSV-2 gD protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hsv 2 Gd
  • View Data Sheet

    Name :

    CMV Pp38

    Description:

    Cytomegalo Virus Pp38 (UL80a) Recombinant

    Product # :

    CMV-213

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The E.Coli derived 52.8kDa recombinant protein contains the CMV Pp38 (UL80a) immunodominant regions, 117-373 amino acids and fused to a GST-Tag at C-terminus.

    Source

    Escherichia Coli.

    Formulation

    1mg/ml in 50mM Tris pH-7.2, 1mM EDTA and 50% glycerol.

    Purity

    CMV Pp38 protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      CMV belongs to the Betaherpesvirinae subfamily of Herpesviridae which includes herpes simplex virustypes 1 and 2, varicella-zoster virus, and Epstein-Barrvirus. The herpesviruses share a characteristic ability to remain latentover long periods. CMV is a double-stranded linear DNA virus with 162 hexagonal protein capsomeres surrounded by a lipid membrane. CMV has the largest genome of the herpes viruses, ranging from 230-240 kilobase pairs. Human CMV is composed of unique and inverted repeats that include the existence of 4 genome isomers caused by inversion of L-S genome components (class E). Replication may be divided into immediate early, delayed early, and late gene expression based on time of synthesis after infection. The DNA is replicated by rolling circles. In vitro, CMV replicates in human fibroblasts.

    • Stability

      CMV Pp38 Protein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Purification Method

      CMV Pp38 was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Cmv Pp38
  • View Data Sheet

    Name :

    HCV Core Genotype-3/10

    Description:

    Hepatitis C Virus Core Genotype-3/10 Recombinant

    Product # :

    HCV-201

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119.

    Source

    Escherichia Coli.

    Formulation

    50mM Tris-HCl, pH-8, 60mM NaCl, 10mM glutathione, 0.25% sarkosil & 50% glycerol.

    Purity

    HCV Core Genotype-3/10 protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV Core Genotype-3/10 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      HCV Core Genotype-3/10 antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV Core Genotype-3/10 protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Core Genotype 3 10
  • View Data Sheet

    Name :

    HCV NS3 2b

    Description:

    Hepatitis C Virus NS3 Genotype-2b, (1356-1459 a.a.) Recombinant

    Product # :

    HCV-250

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to a GST tag at N-Terminus.

    Formulation

    1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.

    Purity

    HCV NS3 Genotype-2b protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV NS3 Genotype-2b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      HCV NS3 Genotype-2b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV NS3 Genotype-2b protein was Purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns3 Genotype 2B 1356 1459
  • View Data Sheet

    Name :

    HCV NS4 a+b

    Description:

    Hepatitis C Virus NS4 a+b Recombinant

    Product # :

    HCV-264

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus, pI 5.45.

    Formulation

    20mM Tris-HCl pH 8, 8M urea.

    Purity

    HCV NS4 a+b protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV NS4 a+b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Amino Acid Sequence

      1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREF
      DEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNW
      QKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQ
      TLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGA
      GVAGAL 1863.

    • Applications

      HCV NS4 a+b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV NS4 a+b protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns4 Ab
  • View Data Sheet

    Name :

    HCV NS5

    Description:

    Hepatitis C Virus NS5 Recombinant

    Product # :

    HCV-235

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the HCV NS5a immunodominant regions, amino acids 2061-2302. The protein is fused with GST at N-terminus.

    Formulation

    1.5M Urea, 25mM Tris-HCl pH 8, 50% glycerol and 0.2% Triton-X.

    Purity

    HCV-NS5 protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV NS5 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      HCV-NS5 antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV-NS5 protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns5
  • View Data Sheet

    Name :

    HCV NS4 a+b Rhodamine

    Description:

    Hepatitis C Virus NS4 a+b Rhodamine Labeled Recombinant

    Product # :

    HCV-226

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived 19 kDa recombinant protein rhodamine labeled contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus.

    Formulation

    20mM Tris-Hcl pH 8, 8M urea and 10mM B-ME.

    Purity

    Protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV NS4 a+b Rhodamine although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      Antigen in ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      Purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns4 Ab Rhodamine
  • View Data Sheet

    Name :

    HCV Core NS3

    Description:

    Hepatitis C Virus Nucleocapsid (core) NS3 Recombinant

    Product # :

    HCV-008

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    Recombinant HCV protein produced in E.Coli containing the Core (130 a.a.) and NS3 (236 a.a.) excluding NS4 and NS5 domains having a total Mw of 45kDa and purified by proprietary chromatographic techniques.

    Source

    Escherichia Coli.

    Formulation

    Sterile filtered solution containing PBS, 1M urea and 25mM Arginine.

    Purity

    Greater than 95.0% as determined by SDS-PAGE.

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Physical Appearance

      Sterile filtered colorless solution.

    • Stability

      Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Core Ns3
  • View Data Sheet

    Name :

    HCV NS4 a+b, Fluoroscein

    Description:

    Hepatitis C Virus NS4 a+b. Fluoroscein Recombinant

    Product # :

    HCV-268

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived 19 kDa recombinant protein Fluoroscien labeled contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus.

    Formulation

    20mM Tris-Hcl pH 8, 8M urea & 10mM B-ME.

    Purity

    HCV NS4 a+b Fluoroscein protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV NS4 a+b Fluoroscein although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      HCV NS4 a+b Fluoroscein antigen in ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV NS4 a+b Fluoroscein protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns4 Ab Fluoroscein
  • View Data Sheet

    Name :

    HIV-1 gp41 16kDa

    Description:

    HIV-1 gp41 16kDa Recombinant

    Product # :

    HIV-004

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    Recombinant HIV-1 gp41 Subtype B produced in E.coli is a non-glycosylated polypeptide chain having a molecular mass of 16kDa and fused to a His tag at N-terminus.

    Source

    Escherichia Coli.

    Formulation

    Lyophilized from 1mg/ml in 20mM Na-carbonate, pH 9.6.

    Purity

    Greater than 95.0% as determined by SDS-PAGE.

    More Info

    • Introduction

      Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.

    • Physical Appearance

      Sterile Filtered White lyophilized (freeze-dried) powder.

    • Stability

      HIV-1 gp41 although stable at room temperature for 4 weeks, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Solubility

      It is recommended to reconstitute the lyophilized HIV-1 gp41 in sterile 18M-cmH2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hiv 1 Gp41 16Kda
  • View Data Sheet

    Name :

    SARS Spike Mosaic

    Description:

    SARS-Associated Coronavirus Spike Mosaic, Recombinant

    Product # :

    SARS-010

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the Spike Mosaic protein immunodominant regions 20-210 a.a. fused to 6xHis tag at C-terminal.

    Source

    Escherichia Coli.

    Formulation

    SARS Spike Mosaic protein solution is supplied in 1xPBS, pH 7.8.

    Purity

    Protein is >90% pure as determined SDS-PAGE.

    More Info

    • Introduction

      SARS or severe acute respiratory syndrome is a lethal kind of pneumonia generated by coronavirus. Coronaviruses are a family of viruses that causes a mild respiratory tract infection is a large type of creatures such as humans, pigs, cows, mice, cats etc. up to this day, the origin of the coronavirus is still unknown.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      Protein is shipped on ice packs. Upon arrival, Store at -20°C.

    • Antigen Amino Acid Sequence

      RTQLPPAYTN SFTRGVYYPD KVFRSSVLHS TQDLFLPFFS NVTWFHAIHV SGTNGTKRFD NPVLPFNDGV YFASTEKSNI IRGWIFGTTL DSKTQSLLIV NNATNVVIKV CEFQFCNDPF LGVYYHKNNK SWMESEFRVY SSANNCTFEY VSQPFLMDLE GKQGNFKNLR EFVFKNIDGY FKIYSKHTPI

    • Specificity

      Immunoreactive with sera of SARS Associated Coronavirus infected individuals.

    • Purification Method

      Purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    product_image.jpg
  • View Data Sheet

    Name :

    CoV-2 N (196 a.a.)

    Description:

    Coronavirus 2019 Nucleocapsid (196 a.a.), Recombinant

    Product # :

    SARS-042

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    The E.Coli derived recombinant protein contains the Coronavirus 2019 middle region a.a. from the Nucleocapsid protein and fused to GST-6xHis tag at N-terminal and having a Mw. Of 48.4 kDa.

    Source

    E.Coli.

    Formulation

    CoV-2 Nucleocapsid protein solution is supplied in 50mM Tris-HCl pH 8, 1M Urea, and 50% Glycerol.

    Purity

    CoV-2 Nucleocapsid protein is >95% pure as determined SDS-PAGE.

    More Info

    • Introduction

      A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.

      The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.

      While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.

    • Physical Appearance

      Sterile Filtered clear solution.

    • Stability

      CoV-2 Spike Protein is shipped on ice packs. Upon arrival, Store at -20°C.

    • Purification Method

      NTA Sepharose-Affinity Purification.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    product_image.jpg
  • View Data Sheet

    Name :

    HCV NS3 1b

    Description:

    Hepatitis C Virus NS3 Genotype-1b, (1356-1459 a.a.) Recombinant

    Product # :

    HCV-249

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to a 22kDa proprietary GST tag at N-Terminus.

    Formulation

    1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.

    Purity

    HCV NS3 Genotype-1b protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      NS3 Genotype-1b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      HCV NS3 Genotype-1b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV NS3 Genotype-1b protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns3 Genotype 1B 1356 1459
  • View Data Sheet

    Name :

    Ebola Zaire GP

    Description:

    Ebola Zaire Glycoprotein Recombinant

    Product # :

    EVD-077

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    Recombinant Ebola Zaire Glycoprotein is a mucin like domain containing 181 amino acids was derived from Zaire Ebola Virus (strain Kikwit-95) gp mucin sequence produced in E. coli, and fused to a 6xHis tag at its C-terminus, having a molecular weight 38kDa.Ebola Zaire GP is purified by a proprietary chromatographic technique.

    Source

    Escherichia Coli.

    Formulation

    Ebola Zaire GP protein solution is supplied in Phosphate buffer with 25mM arginine and 0.02% sodium azide.

    Purity

    >95% pure as determined by 12% SDS-PAGE (Coomassie blue stain).

    More Info

    • Introduction

      Ebolavirus (EVD) belongs to the Filoviridae family of proteins which is comprised of a single-strand, non-infectious RNA genome. EVD genome is about 19,000 base pairs long and covers 7 genes in the order 3'-UTR-NP-VP35-VP40-GP-VP30-VP24-L-5'-UTR. There are 4 different ebolaviruses such as: Zaire (EBO-Z), Sudan (EBO-S), Cote d’Ivoire (EBO-CI) and Reston (EBO-R) that differ in amino acid sequence and location of where the gene overlaps. The EBOV glycoprotein is the only virally expressed protein above the virion surface. The EBOV glycoprotein is essential for virus attachment to host cell and fusion with target cell. Mucin like domain within Ebola virus glycoprotein contains multiple glycosylated amino acids. It has been shown that antibodies frequently develop against its mucin like domain. Recombinant mucin like domain is a suitable antigen to test specific antibodies from Ebola virus infected patients.

    • Stability

      Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

    • Applications

      Immunoassay.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Ebola Zaire Gp
  • View Data Sheet

    Name :

    Zika Ectodomain

    Description:

    Zika Ectodomain Recombinant

    Product # :

    ZKV-006

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    Recombinant Zika Ectodomain is a glycosylated protein, produced using baculovirus vectors in insect cells and its Mw is approximately 45kDa.The Zika Ectodomain is a recombinant protein of the ectodomain of the envelope protein from the Suriname Zika virus strain.

    Source

    Baculovirus Insect Cells.

    Formulation

    The Zika Ectodomain solution 10mM Sodium phosphate, pH 7.2, 150mM NaCl.

    Purity

    Greater than 90.0% as determined by SDS-PAGE.

    More Info

    • Introduction

      Zika virus (ZIKV) belongs to the family Flaviviridae and the genus Flavivirus, it is transmitted by daytime-active Aedes mosquitoes, such as A. aegypti and A. albopictus. The Zika virus is related to the dengue, yellow fever, Japanese encephalitis, and West Nile viruses. Much like the other flaviviruses, Zika virus is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Zika fever is an infection, which often causes no symptoms or only mild ones, like a mild form of dengue fever, and it is treated by rest. As of February 2016, there has been mounting evidence that Zika fever in pregnant women can cause abnormal brain development in their fetuses by mother-to-child transmission, which may result in miscarriage or microcephaly, however it is not yet known whether Zika virus causes microcephaly. Furthermore, a connection has been established with neurologic conditions in infected adults, including Guillain–Barre syndrome.

    • Physical Appearance

      Sterile Filtered solution.

    • Stability

      Zika Ectodomain should be stored at 4°C. Do not freeze!

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Zika Ectodomain
  • View Data Sheet

    Name :

    HAVCR1 Human, HEK

    Description:

    Hepatitis A Virus Cellular Receptor 1 Human Recombinant, HEK

    Hepatitis A Virus Cellular Receptor 1, T-Cell Immunoglobulin Mucin Family Member 1, T-Cell Immunoglobulin Mucin Receptor 1, T-Cell Membrane Protein 1, Kidney Injury Molecule 1, HAVCR-1, TIMD-1, HAVCR, KIM-1, TIM-1, TIMD1, TIM1, KIM1, TIM, T-Cell Immunoglobulin And Mucin Domain-Containing Protein 1, T Cell Immunoglobin Domain And Mucin Domain Protein 1, HAVCR1.

    Product # :

    HAV-223

    Price :

    Quantity :

    Shipping Method :

    Room Temp Icon

    Shipped at Room temp

    Add To Cart

    More Info

    • description
    • source
    • formulation
    • purity
    • More Info

    Description

    HAVCR1 Human Recombinant produced in HEK cells is a single, glycosylated, polypeptide chain (Ser21-Thr288) containing a total of 283 amino acids, having a calculated molecular mass of 30.5kDa. HAVCR1 is fused to a 2 aa N-terminal linker, a 2 aa C-terminal linker and a 6 aa His tag at C-Terminus.

    Source

    HEK 293.

    Formulation

    HAVCR1 was filtered (0.4µm) and lyophilized from 0.5mg/ml solution in phosphate buffered saline and 5% (w/v) Trehalose.

    Purity

    Greater than 90.0% as determined by SDS-PAGE.

    More Info

    • Introduction

      Hepatitis A virus cellular receptor 1 (HAVCR1) is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. HAVCR1 is a type I trans-membrane structural glycoprotein located in the renal proximal tubule epithelial cells. HAVCR1 protein may be involved in the control of asthma and allergic diseases. The reference genome represents an allele which retains a MTTVP amino acid segment that presents defense against atopy in HHAV seropositive individuals.

    • Synonyms

      Hepatitis A Virus Cellular Receptor 1, T-Cell Immunoglobulin Mucin Family Member 1, T-Cell Immunoglobulin Mucin Receptor 1, T-Cell Membrane Protein 1, Kidney Injury Molecule 1, HAVCR-1, TIMD-1, HAVCR, KIM-1, TIM-1, TIMD1, TIM1, KIM1, TIM, T-Cell Immunoglobulin And Mucin Domain-Containing Protein 1, T Cell Immunoglobin Domain And Mucin Domain Protein 1, HAVCR1.

    • Physical Appearance

      Filtered White lyophilized (freeze-dried) powder.

    • Stability

      Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.

    • Solubility

      It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. HAVCR1 is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

    • Amino Acid Sequence

      ASSVKVGGEA GPSVTLPCHY SGAVTSMCWN RGSCSLFTCQ NGIVWTNGTH VTYRKDTRYK LLGDLSRRDV SLTIENTAVS DSGVYCCRVE HRGWFNDMKI TVSLEIVPPK VTTTPIVTTV PTVTTVRTST TVPTTTTVPM TTVPTTTVPT TMSIPTTTTV LTTMTVSTTT SVPTTTSIPT TTSVPVTTTV STFVPPMPLP RQNHEPVATS PSSPQPAETH PTTLQGAIRR EPTSSPLYSY TTDGNDTVTE SSDGLWNNNQ TQLFLEHSLL TANTTKLHHH HHH.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Havcr1 Human Hek
  • View Data Sheet

    Name :

    HCV Core 22kDa

    Description:

    Hepatitis C Virus Core 22kDa Recombinant

    Product # :

    HCV-241

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the HCV core nucleocapsid genotype 1b, immunodominant regions, amino acids 2-192, 22kDa.The protein is fused with b-galactosidase (114 kDa) at N-terminus.

    Formulation

    20mM Tris HCl pH-8, 8M urea and 10mM b-mercaptoethanol.

    Purity

    HCV-Core Protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV-Corealthough stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Amino Acid Sequence

      mstnpkpqrk tkrntnrrpq dvkfpgvgqi vggvyllprr gprlgvratr ktsersqprg rrqpipkarr pegrtwaqpg ypwplygneg cgwagwllsp rgsrpswgpt dprrrsrnlg kvidtltcgf adlmgyiplv gaplggaara lahgvrvled gvnyatgnlp gcsfsiflla llscltvpa

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV-Core protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Core 22Kda
  • View Data Sheet

    Name :

    HCV NS3 (1192-1459 a.a.)

    Description:

    Hepatitis C Virus NS3 Genotype-1b, (1192-1459 a.a.) Recombinant

    Product # :

    HCV-247

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. The protein is fused to a GST tag at N-Terminus.

    Formulation

    1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.

    Purity

    HCV NS3 Genotype-1b protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNA virus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      NS3 Genotype-1b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      ELISA, Western blots and Flow-through.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV NS3 Genotype-1b protein was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns3 Genotype 1B 1192 1459
  • View Data Sheet

    Name :

    HCV NS3 1a

    Description:

    Hepatitis C Virus NS3 Genotype-1a, (1356-1459 a.a.) Recombinant

    Product # :

    HCV-248

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add To Cart

    More Info

    • description
    • formulation
    • purity
    • More Info

    Description

    The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to a GST tag at N-Terminus.

    Formulation

    1.5M urea, 25mM Tris-HCl pH-8, 0.2% Triton-X & 50% Glycerol.

    Purity

    HCV NS3 Genotype-1a protein is >95% pure as determined by 10% PAGE (coomassie staining).

    More Info

    • Introduction

      HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
      HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).

    • Stability

      HCV NS3 Genotype-1a although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

    • Applications

      HCV NS3 Genotype-1a antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.

    • Specificity

      Immunoreactive with sera of HCV-infected individuals.

    • Purification Method

      HCV NS3 Genotype-1a was purified by proprietary chromatographic technique.

    ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

    Hcv Ns3 Genotype 1A 1356 1459
  • 1
  • …
  • 12
  • 13
  • 14
  • 15
  • 16
  • …
  • 42
Your browser does not support the video tag.

Products

  • Cytokines
  • Growth Factors
  • Chemokines
  • CD Antigens
  • Neurotrophins
  • Hormones
  • Enzymes
  • Viral Antigens
  • Recombinant Proteins
  • Natural Proteins
  • Monoclonal Antibodies
  • Polyclonal Antibodies
  • Thermal Packaging

About

  • Company
  • Founder
  • Contribution
  • Contact Us
  • My Account

Ordering

  • Ordering Method
  • Ordering - Credit Card
  • Ordering PO
  • Shipping Fees
  • FAQ's

Legal

  • Terms & Conditions
  • Privacy
  • Site Map
  • info@prospecbio.com
  • Facebook
  • Instagram
  • Linkedin Profile

© 2026 ProSpec-Tany TechnoGene Ltd. All Rights Reserved.

  • Choosing a selection results in a full page refresh.
  • Opens in a new window.