TGFB2 Antibody

TGFB2 Antibody

Other Polyclonal Antibodies

Name

Description

Product #

Price

Quantity

Shipping Method

  • Name :

    TGFB2 Antibody

    Description:

    Transforming Growth Factor-beta 2 Polyclonal Rabbit Anti Human Antibody

    Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.

    Product # :

    ANT-035

    Price :

    Quantity :

    Shipping Method :

    Ice Icon

    Shipped with Ice Packs

    Add :

  • formulation
  • purity
  • More Info

Formulation

Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.

Purity

Greater than 98%.

More Info

  • Introduction

    TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-b (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.

  • Synonyms

    Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.

  • Physical Appearance

    Sterile Filtered White lyophilized (freeze-dried) powder.

  • Stability

    Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.

  • Solubility

    Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

  • Immunogen

    IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants.

  • Applications

    Western Blot: to detect human TGFb2 by WB analysis this antibody can be used in a dilution of 1/1,000.

  • Antigen Amino Acid Sequence

    ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

  • Type

    Polyclonal Rabbit Antibody.

  • Purification Method

    Purified IgG prepared by affinity chromatography on protein G.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Tgfb2 Antibody

You may also like