prospec
IL 1 beta Rat

IL 1 beta Rat

  • Name
  • Description
  • Cat#
  • Pricings
  • Quantity
  • IL 1 beta Rat

  • Interleukin-1 beta Rat Recombinant
  • CYT-394
  • Shipped at Room temp.

Catalogue number

CYT-394

Synonyms

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Introduction

Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin from synovial cells.

Description

Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.
The IL-1b is purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4, 5% trehalose and 0.02 % Tween-20.

Solubility

It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Stability

Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Purity

Greater than 96.0% as determined by:

 (a) Analysis by RP-HPLC.

 (b) Analysis by SDS-PAGE.

Amino acid sequence

MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF
VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK
KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD
IVDFTMEPVSS.

Biological Activity

The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.

Safety Data Sheet

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top