- Name
- Description
- Cat#
- Pricings
- Quantity
Catalogue number
CYT-300
Synonyms
GH-dependant binding protein, IBP3, BP-53, IGFBP-3.
Introduction
IGFBP3 is a member of the IGFBP family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with IGFALS and either IGF I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Description
IGFBP3 Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 264 amino acids and having a molecular mass of 28806 Dalton.
IGFBP-3 is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2µm filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4.
Solubility
It is recommended to reconstitute the lyophilized IGFBP3 in sterile 20mM AcOH (acetic Acid) not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability
Lyophilized IBP3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C.
Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Amino acid sequence
GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL
RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST
HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN
HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Biological Activity
The ED50, calculated by by its ability to inhibit IGF-II induced proliferation of MCF-7 is < 200ng/ml in the presence of 15ng/ml of Human IGF-II, corresponding to a specific activity of 5.0 × 103 IU/mg.
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Safety Data Sheet
References
Title:The role of IGFBP3 in the growth inhibitory actions of androgens in LNCaP human prostate cancer cells.
Publication:Article first published online: 4 OCT 2007 DOI:10.1002/ijc.23100 Copyright © 2007 Wiley-Liss, Inc.
Link:IGFBP3 prospec publication