- Name
- Description
- Cat#
- Pricings
- Quantity
Catalogue number
HOR-245
Synonyms
Guanylate cyclase activator 2B, UGN, GCAP-II, GUCA2B.
Introduction
Prouroguanylin is a 112-amino-acid prohormone precursor of uroguanylin- mature biologically active 16-amino-acid peptide cleaved from its C-terminus. Guanylin binds to receptor-guanylate cyclases (CG-C) resulting in increased intracellular cGMP levels leading to CFTCR (Cystic Fibrosis Transmembrane Conductance Regulator) activation and subsequent rise in fluid and electrolyte secretion into the lumen.
Prouroguanyline knock-out mice showed impaired renal excretion of external NaCl leading to elevated blood pressure independent of the level of diatary salt intake.
Prouroguanylin is the predominant circulating molecular form found in circulation and in biological fluids.
Prouroguanyline knock-out mice showed impaired renal excretion of external NaCl leading to elevated blood pressure independent of the level of diatary salt intake.
Prouroguanylin is the predominant circulating molecular form found in circulation and in biological fluids.
Description
Prouroguanylin Human Recombinant is 10.7 kDa protein containing 86 amino acid residues of the human prouroguanylin and 10 additional amino acid His Tag.
The Prouroguanylin is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Physical Appearance
Sterile Filtered clear solution.
Formulation
20mM TRIS, 50mM NaCl and 20% (v/v) glycerol, pH 7.5.
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Amino acid sequence
MKHHHHHHASVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLP
AVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Safety Data Sheet
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.