CD44 Human, His

cd-44.

The CD44Human is created as a recombinant protein with a 4kda N-terminal fusion of His Tag. The CD44His-Tagged Fusion Protein, produced in E. coli, is a 28kDa protein containing 175 amino acid residues.

Escherichia Coli.

Filtered White lyophilized (freeze-dried) powder.

Each mg was lyophilized with 1xPBS, 0.4% SDS and 4mM DTT.

It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it on cell culture.

Store lyophilized CD44 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.

Greater than 95.0% as determined by SDS-PAGE.

EETATQKEQWFGNRWHEGYRQTPREDSHSTTGTAAASAHTSHPMQG RTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSTTLQPTANP NTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRN DVTGGRRDPNHSEGSTTLLEGYTSHYPHTK

SDS

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

CD44 is a cell-surface glycoprotein which take part in migration, cell-cell interactions and cell adhesion.  CD44 is a receptor of hyaluronic acid which interacts with other ligands such as collagens, osteopontin and matrix metalloproteinases. CD44 has various of functions such as lymphocyte activation, tumor metastasis, recirculation & homing and hematopoiesis.