- Name
- Description
- Cat#
- Pricings
- Quantity
Catalogue number
CYT-081
Synonyms
BMP4, ZYME, BMP2B, BMP2B1.
Introduction
The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Description
BMP-4 Human Recombinant produced in HEK cells is a glycosylated disulfide linked homodimer, having a total molecular weight of 34kDa.
The BMP-4 is purified by proprietary chromatographic techniques.
The BMP-4 is purified by proprietary chromatographic techniques.
Source
HEK.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The BMP-4 was lyophilized from 1.07mg/ml in 2xPBS+6% ethanol.
Solubility
It is recommended to reconstitute the lyophilized BMP-4 in sterile 4mM HCl containing 0.1% endotoxin-free recombinant HSA.
Stability
Lyophilized BMP4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-4 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity
Greater than 95% as obsereved by SDS-PAGE.
Amino acid sequence
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST
NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR.
Biological Activity
The specific activity was determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) and is typically 2.9ng/ml corresponding to a Specific Activity of 220,750.55IU/mg.
Safety Data Sheet
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.