prospec
TGFB2 Antibody

TGFB2 Antibody

  • Name
  • Description
  • Cat#
  • Pricings
  • Quantity
  • TGFB2 Antibody

  • Transforming Growth Factor-beta 2 Polyclonal Rabbit Anti Human Antibody
  • ANT-035
  • Shipped with Ice Packs

Catalogue number

ANT-035

Synonyms

Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.

Type

Polyclonal Rabbit Antibody.

Introduction

TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-b (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Purity

Greater than 98%.

Immunogen

IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants.

Antigen Amino Acid Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA
SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Purification Method

Purified IgG prepared by affinity chromatography on protein G.

Formulation

Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.

Solubility

Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

Applications

Western Blot: to detect human TGFb2 by WB analysis this antibody can be used in a dilution of 1/1,000.

Stability

Store at -20°C. For long term storage freezes in working aliquots at -20°C. 
Repeated freezing and thawing is not recommended.

Safety Data Sheet

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top