EBV p23, His

The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalovirus. On infecting the B-lymphocyte, the linear virus genome circularizes and the virus subsequently persists within the cell as an episome. The virus can execute several distinct programs of gene expression which can be broadly categorized as being lytic cycle or latent cycle. The lytic cycle or productive infection results in staged expression of a host of viral proteins with the ultimate objective of producing infectious virions. Formally, this phase of infection does not inevitably lead to lysis of the host cell as EBV virions are produced by budding from the infected cell. The latent cycle (lysogenic) programs are those that do not result in production of virions. A very limited, distinct set of viral proteins are produced during latent cycle infection. These include Epstein-Barr nuclear antigen (EBNA)-1, EBNA-2, EBNA-3A, EBNA-3B, EBNA-3C, EBNA-leader protein (EBNA-LP) and latent membrane proteins (LMP)-1, LMP-2A and LMP-2B and the Epstein-Barr encoded RNAs (EBERs).

The E.Coli derived recombinant protein contains the HHV-4 p23 regions, 10- C-end amino acids having a Mw of 17.7kDa.

Purified by proprietary chromatographic technique.

Protein is >95% pure as determined by 10% PAGE (coomassie staining).

1xPBS pH-7.5 and 300mM Imidazole.

Immunoreactive with sera of EBV-infected individuals.

SAPRKVRLPSVKAVDMSMEDMAARLARLESENKALKQ
QVLRGGACASSTSVPSAPVPPPEPLTARQREVMITQATG
RLASQAMKKIEDKVRKSVDGVTTRNEMENILQNLTLRIQ
VSMLGAKGQPSPGEGTRPRESNDPNATRRARSRSRGRE
AKKVQISD.

Antigen in ELISA and Western blots, excellent antigen for detection of HHV-4 (EBV) with minimal specificity problems.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.